(data stored in ACNUC7421 zone)

EMBL: CP000272.PE86

CP000272.PE86        Location/Qualifiers
FT   CDS_pept        99417..100823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0088"
FT                   /product="Putative selenium binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36014"
FT                   /db_xref="GOA:Q13IS5"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS5"
FT                   /protein_id="ABE36014.1"
FT                   /translation="MGMRPDPTFHASPKLAMDAPAENYAYTLLLSPDFSQPDALAVIDV
FT                   KPGSPTYSKVVHTVPVPNKGDEFHHFGWNACSSALSPLTGHAFLERRYLIIPGMRSSRI
FT                   YIVDTKPHPTQARLHKIIEPEEIFRKTGYSRPHTVHCGPEGIYVSTLGGGGKEGTDGPP
FT                   GIFIMDCETFEVLGRWEIDRGPQEKHYDFWWNLPRDYMVSSEWALPPQFENGIVAEDLL
FT                   SNRYGHHIHFWDLRARRNVQSIDLGANHQMALEVRPAHDPSREYGFIGVVVDTTNLEGS
FT                   IWTWWREGGQFHIEKTATIPPEPAAAELLPPLLQGFGAVPPLVTDIDLSIDDKFLYVAC
FT                   WGTGEMRQYDVTDPRKPKLAGSVHIGGIARRTPHPNGETFAGGPQMVEISRDGKRVYWT
FT                   NSLYSSWDNQFYPNGVPAAQVMARAEPGGGLTLADDYWVAFPDGYRAHQIRLEGGDCST
FT                   DSFCYPSVGI"
     atgggtatgc gtccagatcc cacgttccac gcatcgccga aactcgcgat ggatgcgcca        60
     gcagagaatt acgcctacac gttgctgctc agccccgatt tctcgcagcc tgacgcgctt       120
     gccgtcatcg acgtgaagcc cggctcgccg acctacagca aggtggttca cacggttcca       180
     gtgccgaaca aaggggacga attccatcat ttcggctgga acgcctgctc gtcggcgtta       240
     tcgccattga ccggccacgc cttcctcgaa cgacgctatc tgatcattcc ggggatgcgc       300
     tcttcgcgca tttacatcgt ggacaccaag cctcatccga cccaggcgcg gcttcacaag       360
     atcatcgagc ccgaggaaat cttccgtaaa acaggctact cccgtccgca cacggttcat       420
     tgcgggcccg aagggatcta cgtcagcacg ctaggtggcg gcggaaaaga gggcaccgac       480
     gggcccccgg gcattttcat catggactgc gagacgttcg aggttctcgg ccggtgggag       540
     atagaccgcg gtccgcagga aaaacactac gatttctggt ggaacctgcc acgtgattac       600
     atggtgtcga gcgagtgggc cttgccgccg cagttcgaga acgggatcgt cgccgaggat       660
     cttctgtcga accggtacgg gcaccacatc cacttctggg atctgcgggc gaggcgcaac       720
     gtgcagagca tcgacctcgg cgcgaaccac cagatggcac tcgaagtgcg gcccgcgcac       780
     gatcccagcc gcgagtacgg gttcatcggc gtggtggtcg atacgacgaa cctggaaggg       840
     tcgatctgga cctggtggcg cgaaggcgga cagttccata tcgagaagac ggcgaccatt       900
     ccgcccgagc ccgccgctgc ggaactactg ccaccgctgc ttcaggggtt cggcgcggtg       960
     ccgccgctcg tcacggacat cgatctgtcc atcgacgaca aattcctcta cgtcgcctgc      1020
     tggggaaccg gcgagatgcg tcagtacgac gtgacggatc cgcgcaagcc gaagcttgca      1080
     ggctcggttc acatcggcgg gatcgcgcgg cgcacgccgc atccgaacgg tgagactttt      1140
     gcgggcggcc cgcagatggt tgagatcagc cgcgatggca agcgggtcta ttggaccaac      1200
     tccctgtatt cgagctggga caaccagttc tatccgaacg gcgtgcccgc ggcgcaggtc      1260
     atggcacgcg ccgaacccgg cggcggcctc acgctggccg atgattactg ggtggccttt      1320
     cccgatggct accgggctca ccagatcagg ctggaaggag gcgattgctc gaccgattcg      1380
     ttttgctacc cgtcggtggg catttga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page