(data stored in ACNUC7421 zone)

EMBL: CP000272.PE88

CP000272.PE88        Location/Qualifiers
FT   CDS_pept        complement(101700..102887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0090"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36016"
FT                   /db_xref="GOA:Q13IS3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS3"
FT                   /protein_id="ABE36016.1"
FT                   /translation="MSVPSRQRPSFLRRKLLGTAVALALGGIASIAPAAAPASGEPVLF
FT                   GVSGPLSGPNAQYGAQWKAGFDLALDQINRDGGIHGRPLQYVFEDSQSDPRQAVTIAQK
FT                   FVGDPRILIELGDFSSPASMAASPIYQRAGLVQLGFTNSHPDFTKGGDFIWSPSVSQAD
FT                   AQPLLAELAAKQGFKRVAVLYQNTDWGRASKDVFVKAAASRGIQVVASEGYQPTDKDFR
FT                   ATLLRLRDANPDALVLISYYSDGAQIVRQARGSGLHTPIVAASSVYSPKFMELGGDAVN
FT                   GVTTNTSFFPDDPRPEVQHFVRTFEAKYHQQPDAFNAFAYDAAIIAAYALRAGGLDRRG
FT                   VRDALPRLRDVPSVVFGRATFDPATRRVIGVRSVNLVVDHGRWVLLSAKSSLAAK"
     atgtccgtcc cgtctcgcca gcgtccttca ttcctgcgcc gcaagctgct gggcacggcc        60
     gtcgcactcg cgctcggcgg catcgcgagc attgcgccag ccgccgcgcc agccagcggc       120
     gagcctgtgc tgttcggtgt cagcggtccg ttgagcggcc ccaacgcaca atacggcgcg       180
     cagtggaaag cgggcttcga tctcgccctg gatcagatca accgcgacgg cggcatccac       240
     ggccggccgc tgcagtatgt tttcgaggac agtcaaagcg atccgcgcca ggctgtgacg       300
     atcgcgcaga aattcgtggg cgacccgcgc atcctgatcg aactgggcga cttctccagc       360
     ccggcatcga tggcggcatc cccgatctat cagcgcgccg ggctcgtgca actcggtttt       420
     accaactcgc atccggactt caccaagggc ggcgacttca tctggagccc gtcggtcagt       480
     caggcggacg cgcagcccct gctcgctgaa ctggccgcga aacagggctt caaacgcgtc       540
     gccgtgctct atcaaaacac cgactggggc cgcgcgagca aggacgtgtt cgtcaaggcc       600
     gctgcctcgc gcggcatcca ggtggtggcg agcgagggct accagcccac cgacaaggat       660
     tttcgcgcca cgcttttgcg cctgcgcgac gcgaatcccg atgccctcgt gctgatctcg       720
     tactactcgg acggcgcgca gatcgtgcgt caggcacggg gcagcggctt gcacaccccg       780
     atcgtggcag ccagttccgt ctattcaccg aagttcatgg aactcggcgg cgatgcggtc       840
     aacggcgtga cgaccaacac gagctttttt ccggacgatc cgcgccccga agtccagcac       900
     ttcgttcgca ccttcgaggc taaatatcat cagcagccgg acgcgttcaa tgcattcgcg       960
     tacgacgcgg cgatcatcgc cgcctatgcg ttgcgggcgg gcggcctcga ccggcgcggc      1020
     gtgcgcgatg cgctgcccag gcttcgcgac gtccccagcg tggtgttcgg tcgggcgacc      1080
     ttcgatccgg ccacgcggcg cgtgatcggc gtgagaagtg tgaacctggt ggtcgatcac      1140
     ggccggtggg tgttgctcag cgccaaatcg tcgcttgcgg cgaagtaa                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page