(data stored in SCRATCH zone)

EMBL: CP000272.PE93

CP000272.PE93        Location/Qualifiers
FT   CDS_pept        107022..108221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0095"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36021"
FT                   /db_xref="GOA:Q13IR8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR8"
FT                   /protein_id="ABE36021.1"
FT                   /translation="MSMVLNRTEIRARAWRGALRALALAAVGALAQINLAHAAGTSSDP
FT                   YWVGVTGPLSGQDAQYGEQWKRGFDLALEQINGSGGIDGHPLNYDFEDSRSDPRQAVQI
FT                   AQKFVDDKRILLELGDLSSGASMAASPVYQRGGLVQFGFTNSHPDFTKGGDYMWSTAIS
FT                   QAEEQPMLAHYATTGLGFKKIAVLYLNTDWGRTSKDIFAKAATSDGAQVVAAEGYQPNE
FT                   KDFRATLTRIRSANPDSIVLISYYSDGAQIVRQARAAGVREPIAAVGSVYSPKFLELGG
FT                   AAVNGVYTESNFFPGDPRPEVQSFVTRYRAKYGGDPDTFAARAYDAMILAGEVIRRYGA
FT                   NRSAVRDGFAKIDNVPSVIFGKFKFDPQTRRVAGAKNRELVVKDGKFALWNGAQATRAQ
FT                   "
     atgtcgatgg tgttgaacag aacggaaatt cgcgcccgcg catggcgcgg cgcgcttcgc        60
     gcattggcgc tcgccgccgt cggcgcgctc gcgcagatca atctggcgca tgcggcgggc       120
     acgtcgtcag atccttattg ggtgggcgtc accggtcccc tgagcggaca ggacgcgcaa       180
     tacggcgaac agtggaagcg cggtttcgat cttgcactgg agcagatcaa cggtagcggc       240
     ggcatcgacg gtcacccctt gaattacgat ttcgaagaca gccgcagcga tccgcgccag       300
     gccgtgcaga tcgcccagaa attcgtcgac gacaagcgga ttctgctcga actcggggac       360
     ctgtcgagcg gcgcgtcgat ggctgcctcg ccggtctatc aacgcggcgg gctcgtgcag       420
     ttcggcttca ccaactcgca tccggacttc acgaagggcg gcgactatat gtggagcacc       480
     gcgatcagcc aggcggaaga gcagccgatg ctggcgcact acgcgacgac cggtctcggc       540
     ttcaaaaaga tcgccgtgct ttatctgaac accgactggg gccgcaccag caaggatatc       600
     ttcgcgaagg ccgcgacgtc ggacggcgct caggtcgtcg cggcggaagg ctaccagccg       660
     aacgagaagg actttcgtgc aacgctcacg cgcattcgca gcgcgaatcc ggattcgatc       720
     gtgctgattt cgtactactc ggacggcgcc cagatcgtcc ggcaggcgcg tgccgccggt       780
     gtgcgcgagc cgatcgccgc ggtcggttcg gtgtattcgc cgaaattcct ggaactgggc       840
     ggtgccgccg tgaacggcgt ctatacggaa tcgaatttct tcccgggcga tccgcgcccc       900
     gaagtgcaga gcttcgtcac gcgctatcgc gcgaaatacg gcggcgatcc ggacactttt       960
     gcggcgcgcg cctacgacgc gatgattctt gccggcgaag tgatccgccg ctacggcgcg      1020
     aaccgcagcg cggtgcgcga cggcttcgcg aagatcgaca acgtgccgag cgtgattttc      1080
     ggcaagttca aattcgatcc gcaaacgcgg cgcgtcgcgg gcgcgaagaa tcgcgaactc      1140
     gtcgtgaagg acggcaagtt cgcgctgtgg aacggcgcgc aggcgacgcg cgcgcaatga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page