(data stored in ACNUC7421 zone)

EMBL: CP000272.PE95

CP000272.PE95        Location/Qualifiers
FT   CDS_pept        110102..111010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0097"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36023"
FT                   /db_xref="GOA:Q13IR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR6"
FT                   /protein_id="ABE36023.1"
FT                   /translation="MNPASVSGRDILFDVRRVTRRFDGLTAVDGVSLSVARGECVSVIG
FT                   PNGAGKSTLFNLLTGMDVPDEGEIRLDGEDVTGTSPERLAARGVARTFQHGRVFGNLSV
FT                   LDNVLIGAHSRLALARPGWPVLGAFSEVVRALVRPSALRREEAALRADAEAIIARFGTR
FT                   LTPRIEQPAHSLSYANRRRVEIARALALRPRMLLLDEPTAGMNESETAEMLELILDLKR
FT                   DGLTILLIEHKLDLVMRLSDRVIVLDDGRKIAAGLPDAVRNDPAVIDAYLGHRHVGAQA
FT                   GPAAQAVAARSDSTVTGAQHA"
     atgaaccctg catcggtaag cggccgggac atcctgttcg acgtgcggcg cgtgacgcgc        60
     cgcttcgacg gcctgaccgc ggtggatggc gtgagcctgt cagtggcgcg cggcgaatgc       120
     gtgagcgtga tcggcccgaa cggcgcgggc aagtcgacgc tgttcaatct gctgaccggc       180
     atggatgtgc cggacgaagg cgagattcgc ctcgacggtg aggacgtgac cggtacttcg       240
     ccggaacgcc tcgccgcgcg cggcgtagcg cgcacgtttc agcacggccg cgtgttcggc       300
     aacctgagcg tgctcgataa cgtgttgatc ggcgcgcatt cccggcttgc gctggcgcgt       360
     ccaggctggc ccgtgctcgg cgcgttctcg gaagtggtcc gcgcgctggt tcggccgtcc       420
     gcgcttcggc gcgaggaagc agccttgcgt gccgacgccg aagcgatcat cgcgcgattc       480
     ggcacgcgtc tcacgccgcg catcgagcaa ccggcgcata gcctctcgta tgcgaaccgc       540
     cggcgcgtcg agattgcgcg tgcgctggcg ctgcggccgc gcatgttgct gctcgacgaa       600
     cccaccgcgg gaatgaacga atcggagacc gcggaaatgc tcgagctgat tctcgacctc       660
     aagcgcgatg gactgacgat tctgctgatc gaacataaac tcgatctggt gatgcgcctg       720
     tccgaccgcg tgatcgttct cgacgacggc aggaagatcg cagcgggttt gcctgacgcc       780
     gtgcgcaacg acccggcggt catcgacgcc tatctcggcc atcgtcatgt gggcgcgcaa       840
     gccggaccgg ccgcacaagc ggtcgcggcg cgcagcgact ccacggtgac aggcgcgcaa       900
     cacgcatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page