(data stored in SCRATCH zone)

EMBL: CP000272.PE97

CP000272.PE97        Location/Qualifiers
FT   CDS_pept        complement(111916..112749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0099"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36025"
FT                   /db_xref="GOA:Q13IR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR4"
FT                   /protein_id="ABE36025.1"
FT                   /translation="MSSVTGRPAATPRDSNAAAGGPRIVSGWLARTLLGLTGLAGIVAI
FT                   WWLAIHLIARPDSLAAQFSPGRALAALPSLVTEDRLLVHIATSLRRIAIGLAWALLIGV
FT                   PLGFLIGRIKAFDTALSPTLQFLRMISPLSWMPIAVMSLGVGDRAVYFLLAFAAVWPLV
FT                   MSTAAGVTQIDRRWLQLAESLAATRGEMLWHIFVPGLAAHVLTGVRLAIGILWIVLVPA
FT                   EMLGVSSGLGYLILDTRDRLAYSELTAVILVIGALGFLLDYAARLIYRRCGYEQR"
     ttgtctagcg taaccggtcg cccggccgcc acgcctcgtg acagcaacgc ggcagcgggc        60
     ggcccgcgca tcgtctccgg ctggctggcc cgcacgctgc tcggattgac gggactggcg       120
     ggcatcgtcg cgatctggtg gctggccatc cacctgatcg cccgcccgga cagtctggcc       180
     gcgcagttct cgccaggccg cgcgctcgcg gcgctgccct cgcttgtcac cgaggaccgc       240
     ctgctcgtgc acatcgcgac gagcttgcgg cgcatcgcga tcgggctcgc gtgggcgctg       300
     ctgatcggcg tgccgctcgg ctttctgatc ggccgcatca aggcgttcga caccgcgctc       360
     tcgccgaccc tgcaattcct gcgaatgatt tcgccgctat cgtggatgcc gatcgccgtc       420
     atgtcgctcg gtgtgggcga tcgcgcggtc tactttctgc tcgcatttgc ggccgtgtgg       480
     ccgctcgtga tgagcacggc ggcgggcgtc acgcagatag accggcgctg gctgcaactc       540
     gccgagagcc tcgccgccac tcgcggcgag atgctgtggc acatcttcgt gcccggtctc       600
     gccgcgcatg tgctgactgg cgtgcggctg gcgatcggca ttctgtggat cgtgctggtg       660
     ccggcggaaa tgctcggcgt cagttcggga ctcggctacc tgattctcga cacccgcgac       720
     cggctcgcgt attcggaact gacggccgtg attctggtaa tcggcgcgtt ggggtttttg       780
     ctggattatg cggcacgtct catctatcga cgctgtggct atgagcagcg ctag             834
//

If you have problems or comments...

PBIL Back to PBIL home page