(data stored in SCRATCH zone)

EMBL: CP000272.PE98

CP000272.PE98        Location/Qualifiers
FT   CDS_pept        complement(112742..113932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0100"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36026"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR3"
FT                   /protein_id="ABE36026.1"
FT                   /translation="MCQLPMSRREWLKLASMFTVAGAAPLLAALNARAAENPDAPVRIG
FT                   YLPITDAAPLLVAHNNGYFDASGLAVEKPTLLRSWAQLVEAFLSGQVNVVHLLAPMTIW
FT                   ARYGSQAPAKVVAWNHVNGSALTVAPDIGKLGELGGKTVAVPFWYSIHNVVVQHMLRAQ
FT                   GLVPVLEKDGELKANEVRLIVMSPSDMPPALASRQIAGFIVAEPFNAAAEELKVGKVLR
FT                   FTGDVWKNHACCVVFMHERDLTERAAWSQKVVDAVVKAQVWTRAHPQEAAQLLSKSGRN
FT                   HYTPHSANVLTNVLAPPPGDEGRYLADRAITHADWHAKRIDFQPYPYPAYTEELVRRLK
FT                   ATQVEGNAQFLHQLDPAFVARDLVDDRFVKKSIESAGGMKAFGLAESFTRTETILV"
     atgtgtcagc ttccgatgtc ccgccgcgag tggctcaaac tcgcctcgat gttcaccgta        60
     gccggtgccg cgccgctact cgccgcattg aacgcgcgcg ccgccgagaa ccctgacgcg       120
     cccgtacgta tcggctatct gccgatcacg gacgcggcac ctttgctggt tgcacacaac       180
     aacggctatt tcgacgcgtc ggggctcgcc gtcgaaaaac cgaccctgct gcgcagttgg       240
     gcgcagctcg tcgaagcgtt cctgtcgggt caggtcaatg tggtgcatct gctcgcgccc       300
     atgacgatct gggcacgcta cggcagccag gcacccgcga aagtagtcgc gtggaatcat       360
     gtgaacggct ccgcgctcac ggttgcgccg gacatcggca agctcggcga gctcggcggc       420
     aaaaccgtgg ccgtgccgtt ctggtattcg attcacaacg tcgtggtgca gcacatgtta       480
     cgtgcgcagg ggctcgtgcc ggtgctggag aaggacggcg agctcaaggc gaacgaagtg       540
     cggctgatcg tgatgtcgcc gtcggacatg ccgcccgcgc tcgcttcgag gcagatcgcc       600
     gggttcatcg tcgccgaacc gttcaacgcg gcggccgagg agttgaaagt cggcaaggtg       660
     ctgcgcttta ccggcgacgt ctggaagaat cacgcctgct gcgtcgtgtt catgcatgag       720
     cgcgatctga ccgaacgggc cgcgtggtcg cagaaggtcg tcgacgcggt ggtcaaggcc       780
     caggtctgga cccgcgcgca tccgcaggaa gccgctcagt tgttgtcgaa gagcggccgg       840
     aaccactaca cgccccattc cgccaacgta ttgacgaacg tgctagcgcc gccgcccggc       900
     gacgagggcc gctatctggc cgatcgcgcg atcacgcatg cggactggca tgcgaagcgg       960
     atcgattttc agccgtatcc gtacccagcc tatacggaag aactcgtcag gcggctgaag      1020
     gcgacgcagg tcgaagggaa tgcacagttc ctgcatcaac tcgatcccgc cttcgtggcg      1080
     cgcgatctgg tcgacgaccg tttcgtgaag aagagcatcg agtccgctgg cggcatgaag      1140
     gcgttcggcc tcgccgagag tttcacgcga acggagacga ttcttgtcta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page