(data stored in ACNUC7421 zone)

EMBL: CP000272.PE99

CP000272.PE99        Location/Qualifiers
FT   CDS_pept        complement(113948..114742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0101"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36027"
FT                   /db_xref="GOA:Q13IR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR2"
FT                   /protein_id="ABE36027.1"
FT                   /translation="MSDLTAAGAPRIEVCGVGLRYAQRSVLDGISLRVRPGELVSVLGP
FT                   SGSGKSTLLRIIAGLQQPGAGHVEIDGEILRGPRPDVALAFQDPCLLPWLPVEKNVAFG
FT                   LGFARQPALSRGERRERVTAALQEVGLAHARHYTPRQLSGGMAQRTALARCLARQPRTL
FT                   LLDEPFGALDEVTRADMQRLLVTVVRDTNAATVLVTHDIDEALLVSDRVVVLGAQGTLI
FT                   LQLDIVVAPPRETRVQELGALRIQILQALQDSMTHTPLSAHT"
     atgagcgacc tgactgctgc gggcgcaccg cgcatcgagg tatgcggtgt cggactccgc        60
     tacgcgcaac gcagcgtgct cgacggcatc agcctgcgtg tgcggccagg cgaactagtg       120
     tccgttctcg gtccgagcgg ctcgggcaag tccaccttgc tgcggatcat cgcgggcttg       180
     cagcaacccg gcgcgggaca tgtcgagatc gacggcgaga tcctgcgcgg accgcgcccc       240
     gacgtggcgc tcgcattcca ggatccatgc ctgttgccgt ggctcccggt cgagaagaat       300
     gtcgcgttcg ggctaggctt cgcgcgtcag ccggcactgt cgcgcggcga gcggcgcgag       360
     cgcgtcaccg ccgcgttgca ggaagtgggc ctcgctcacg cgcgccatta cacgccacgg       420
     caactgtccg gcgggatggc gcaacgcaca gcgctcgccc gttgcctcgc gcggcaaccc       480
     cgcacgctgc tgctggacga accgttcggc gcgctcgacg aagtgacgcg cgccgacatg       540
     cagcgtctgc tcgtcaccgt cgtgcgtgac acaaatgcgg ccaccgtgct cgtgacccac       600
     gatatcgacg aagcgctgct ggtctccgat cgcgtcgtcg tgctcggcgc tcagggcacg       660
     ctgatcctgc aactcgacat tgtcgttgcg ccgccgcgcg agacccgcgt acaggagctc       720
     ggcgcgttgc gcatccagat tctccaggcg ttgcaggact cgatgacgca cacgccgctt       780
     tccgcccaca cataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page