(data stored in ACNUC7421 zone)

EMBL: CP000283.PE104

CP000283.PE104       Location/Qualifiers
FT   CDS_pept        complement(120224..120727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0104"
FT                   /product="protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37344"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ5"
FT                   /protein_id="ABE37344.1"
FT                   /translation="MIRYNLRCECGHSFESWFQSSSAYDSQVRRKLVNCPACDSVKVEK
FT                   AIMAPQIVGKKGRGRAPEPAHEVAAGTAVAPQAAESPVAESATPLLLAQERELRTKLKE
FT                   LRDYIVKTADNVGDSFPNEARKMHYGDIEHRPIFGEASPAEAKALIDEGIEVAPLPVLP
FT                   EDRN"
     atgatccgct acaatctgcg atgcgaatgc ggtcactcgt tcgagagctg gttccagagc        60
     tcctcggcct acgactcaca ggtccggcgc aagctggtga attgtccggc ctgcgactcg       120
     gtcaaggtcg agaaggcgat catggcgccg cagatcgtcg gcaagaaagg ccgcggccgc       180
     gcgccggagc cggcgcatga agtcgccgcc ggcacggcgg tcgcaccgca agcggcggag       240
     tcgccggttg ccgaatccgc cacgccgctg ttgctggcgc aggagcgcga gctgcgcacc       300
     aagctgaagg aactgcgcga ctacatcgtc aagaccgccg acaatgtcgg cgacagcttc       360
     cccaacgaag cccgcaagat gcattacggc gacatcgagc accgtccgat cttcggcgag       420
     gcctcgcccg ccgaagccaa ggcgctgatc gacgaaggca tcgaagtcgc gccgctgccg       480
     gtgctgccgg aagatcggaa ttga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page