(data stored in ACNUC7421 zone)

EMBL: CP000283.PE108

CP000283.PE108       Location/Qualifiers
FT   CDS_pept        122868..123170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37348"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ1"
FT                   /protein_id="ABE37348.1"
FT                   /translation="MSEPDDKSADSITYVDIPTAPHVYFDIAPAHGVMANGVEIELAAR
FT                   TLNPLADGTVEVKFVTTARLRCSQAGAQHLRNALDAVLKMIEAAQQSPAAASKLN"
     gtgtccgagc cagacgataa atccgccgac tccatcacct atgtcgacat cccgaccgca        60
     ccgcacgtct atttcgacat cgcgccggcg catggcgtga tggccaatgg cgtcgagatc       120
     gagctcgccg cgcggacgct caatccgctg gcggacggca ccgtcgaggt gaaatttgtc       180
     accaccgcgc ggctgcgctg cagccaggcc ggcgcgcagc atctgcgcaa cgcgctcgac       240
     gcggtgctga agatgatcga ggccgcgcag caaagccccg ctgcggcgtc gaagctgaac       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page