(data stored in ACNUC7421 zone)

EMBL: CP000283.PE112

CP000283.PE112       Location/Qualifiers
FT   CDS_pept        complement(126213..126722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0112"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37352"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY7"
FT                   /protein_id="ABE37352.1"
FT                   /translation="MDAATLRATQAPIKERYKSDPDAALITLTAKGSVDSDGLTCKVET
FT                   GRALATAGLHPATGGSGLELCSGDMLLEALVACAGVTLKSVATAIEVPLTRGDVVAEGD
FT                   LDFRGTLGIDKETPVGFREIRLRFDVGTDAPQDKLDLLLKLTERYCVVYQTIKNGPKVS
FT                   VSLERV"
     atggacgccg ccaccctgcg cgccacccag gcgccgatca aggaacgcta caagtccgat        60
     ccggacgcag ccctgatcac gctgacggcc aagggttcgg tcgacagcga cggcctcacc       120
     tgcaaggtcg agaccgggcg ggcgctggcg accgccggcc tgcatccggc gacgggcggc       180
     tccgggctcg aactgtgttc gggcgacatg ctgctcgagg cgttggtcgc ctgcgccggc       240
     gtgacgctga aatcggtcgc gaccgcgatc gaggtgccgc tgacgcgcgg cgacgtggtg       300
     gccgagggcg acctcgattt ccgcggcacg ctcggcatcg acaaggaaac gccggtcggc       360
     ttccgcgaga ttcgtctccg cttcgacgtc ggcaccgacg cgccgcagga caagctcgat       420
     ctgctgctga agctcaccga acgctattgc gtggtgtacc agaccatcaa gaacggcccg       480
     aaggtgtcgg tgtcgctcga acgggtctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page