(data stored in ACNUC7421 zone)

EMBL: CP000283.PE115

CP000283.PE115       Location/Qualifiers
FT   CDS_pept        complement(128620..129606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0115"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   aliphatic sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37355"
FT                   /db_xref="GOA:Q13EY4"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY4"
FT                   /protein_id="ABE37355.1"
FT                   /translation="MSNISRRAITALIAAAAFLPGVLPVVASAADKPKEIRIDWATYNP
FT                   VSIVLKQQGLLEKEFAKDGISVVWVQSAGSNKALEFLNAGSIDFGSTAGSAALVARING
FT                   NPIKSVYVYSRPEWTALVTAKDSKIASVADLKGKRVAVTRGTDPHIFLVRALLDAGLSQ
FT                   NDITPVLLQHADGKAALIRGDVDAWAGLDPMMAQAEVEEGAKLFFRKPEANTWGILNVR
FT                   EQFLKDNPDLVRRVLAVYEDARKYAVANTDEVKKAFIGVTKLPETVVDKQLKERTELTH
FT                   SRIGAPQRDSILAAGLALQQAGVIQSSVDVKATLDQLIDDQVPLPTN"
     atgtcgaaca tctcacggcg cgccatcacg gcgctgatcg ccgccgccgc gtttctgccg        60
     ggcgtcctgc ctgtcgtggc gtcggcggcc gacaagccga aggaaatccg gatcgattgg       120
     gcgacctata atccggtctc gatcgttctg aagcagcagg gcctgcttga aaaggaattc       180
     gccaaggacg gcatcagcgt cgtctgggtg cagtcggccg gctccaacaa ggcgctggaa       240
     ttcctcaatg ccggctcgat cgatttcggc tccaccgccg gttcggcggc tctggtcgcc       300
     cggatcaacg gcaatccgat caagtcggtc tatgtctatt cgcggccgga atggaccgcg       360
     ctggtgacgg ccaaggattc caagatcgcc tcggtcgccg acctcaaggg caagcgcgtc       420
     gcggtgacgc gcggcaccga tccgcacatc ttcctggtgc gcgcgctgct cgacgccggg       480
     ctcagccaga acgacatcac gccggtgctg ttgcagcacg ccgacggcaa ggccgcgctg       540
     atccgcggcg acgtcgacgc ctgggccggt ctcgatccga tgatggcgca ggccgaagtc       600
     gaggagggcg cgaagctgtt cttccgcaag cctgaagcca acacttgggg tatcctcaat       660
     gtccgggagc agttcctcaa ggacaatccc gatctggtcc gccgcgtgct cgcggtctac       720
     gaggacgcgc gcaagtacgc ggtggccaac actgacgagg tgaagaaggc gttcatcggc       780
     gtcaccaagc tgccggaaac agtggtcgac aagcagctca aggaacgcac cgagttgacg       840
     catagccgga tcggcgcgcc gcagcgcgac tcgatcctgg ccgcgggcct ggcgctgcag       900
     caggccgggg tgattcagtc gtcggtcgat gtgaaggcga cgctcgatca actgatcgac       960
     gaccaggtcc cgctgccgac caactaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page