(data stored in ACNUC7421 zone)

EMBL: CP000283.PE120

CP000283.PE120       Location/Qualifiers
FT   CDS_pept        complement(138274..138702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37360"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX9"
FT                   /protein_id="ABE37360.1"
FT                   /translation="MTGYIDPTKEVFAQFRENDRDGPIHMLNLVRLKPRASYPDGREAT
FT                   GAEAYAAYGRDSLSVFSRLGGRVVWQGAFELMLIGPQQERWDHVFIAEYPGVSAFVEMI
FT                   RDPVYREAVKHRQAAVEDSRLIRLKPIPAGEGFGQIPE"
     atgaccgggt atatcgatcc gaccaaggag gtatttgcgc agtttcgcga gaatgatcgc        60
     gacggcccga tccatatgct caatctggtg cggctgaagc cgcgcgccag ctatcccgat       120
     ggccgcgagg cgaccggcgc ggaagcctat gcggcctatg gacgtgactc gctgtcggtg       180
     ttctcgcgcc tgggcggcag agtggtctgg cagggcgcgt tcgaactgat gctgatcggt       240
     ccccagcagg agaggtggga ccacgtcttc atcgcggaat atccgggcgt gtcggccttc       300
     gtcgagatga tccgcgatcc ggtatatcgc gaggcggtca agcatcgcca ggccgcagtc       360
     gaggattccc ggctgatccg gctgaaaccg attccggcgg gcgaaggttt cggccagatt       420
     ccggagtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page