(data stored in ACNUC7421 zone)

EMBL: CP000283.PE121

CP000283.PE121       Location/Qualifiers
FT   CDS_pept        138971..140191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0121"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37361"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX8"
FT                   /protein_id="ABE37361.1"
FT                   /translation="MKSLYRAAAAAVAAIALTAAPAAAQKKYDTGATDTEIKIGQTVPF
FT                   SGPASAYAGIGKTQAAYMRMINDSGGINGRKINLIQYDDAYSPPKAVEQVRKLVEGDEV
FT                   LLTFQIIGTPSNAAVQKYLNGKKVPQLLASTGATRFTDPKSFPWTMGYNPNYQTEARIY
FT                   ARYILKNHPNAKIGIMYQNDDLGRDYLAGLKAGLGDKAAAMIVAETSYELSDPTVDSQI
FT                   VKLKAAGVDLFFNASTPKFAAQAIKKVADLDWRPIHILDINASPVSSTLKPAGLDISKG
FT                   IISVNYGKDPADPQWKDDPGVAKYLAFMDKYYPEGDKMSTINTYGYSTAQLLVTILKQC
FT                   GDDLTRDNVMKQAANLKNVTGDLSLPGMVINTSPTDYRINKQLQMMKFNGERWELFGQI
FT                   IEDDQAM"
     atgaagagcc tgtatcgggc cgcagccgcg gctgtagctg caatcgctct cacagccgcg        60
     cccgccgcgg cacagaagaa atacgacacc ggcgccaccg acaccgaaat caagatcggc       120
     cagaccgtgc cgttctccgg tcccgcttcg gcctatgccg gtatcggcaa aacccaggcc       180
     gcctatatgc ggatgatcaa cgattccggc ggaatcaatg gccgcaagat caacctcatt       240
     caatatgacg acgcctattc gccgcccaag gcggtcgagc aggtgcgcaa gctggtcgaa       300
     ggcgacgagg ttctgctgac cttccagatc atcgggacgc cgtcgaacgc cgcggtgcag       360
     aaatatctca acggcaagaa ggtgccgcag ctgctcgcct cgaccggcgc gacccgcttc       420
     accgatccga agagtttccc ctggacgatg ggctacaacc cgaactacca gaccgaagcc       480
     cggatctatg cgcgctacat cctgaagaac caccccaatg ccaagatcgg catcatgtac       540
     cagaacgacg acctggggcg tgattacctc gccgggctga aggcgggact cggcgacaag       600
     gccgccgcga tgatcgtggc ggagacctcc tacgaactgt ccgacccgac cgtcgactcg       660
     cagatcgtca agctcaaggc cgccggcgtc gacctcttct tcaacgcctc gacgccgaaa       720
     ttcgccgcgc aggcgatcaa gaaggtcgcc gacctcgact ggcgcccgat ccacattctc       780
     gacatcaatg cgagcccggt gtcctcgacg ctgaaaccgg cgggcctgga catctccaag       840
     ggcatcatca gcgtcaatta cggcaaggac ccggccgacc cgcaatggaa ggacgatccc       900
     ggcgtcgcga aatatctcgc cttcatggac aagtactatc cggagggtga caagatgtcg       960
     acgatcaaca cctacggcta ctcgaccgcg caattgctgg tcaccatcct gaagcaatgc      1020
     ggcgacgacc tcacccgcga caacgtcatg aaacaggcgg cgaatctcaa gaacgtgacc      1080
     ggcgacctgt cgctgccggg catggtgatc aacacctcgc cgaccgatta tcgcatcaac      1140
     aagcagcttc agatgatgaa gttcaacggc gagcgctggg agctgttcgg ccagatcatc      1200
     gaagacgacc aagcgatgta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page