(data stored in ACNUC7421 zone)

EMBL: CP000283.PE123

CP000283.PE123       Location/Qualifiers
FT   CDS_pept        complement(140960..141211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37363"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX6"
FT                   /protein_id="ABE37363.1"
FT                   /translation="MNRMQKTAEEIEALLLQDVRQQRHCGKVEAIRIRPCEPDEDTNGA
FT                   NWKVASVDPGQASREFAGAAVMIAMDRLQREVSAFPWD"
     atgaaccgga tgcagaagac cgccgaggag atcgaggccc tgttgcttca ggacgtccgc        60
     cagcagcgtc attgcggcaa ggtcgaggcc atccgcatcc gcccctgcga gccggacgag       120
     gacactaacg gcgccaactg gaaggttgcc tcggtcgatc ccggccaagc cagccgcgaa       180
     ttcgccggcg ccgcggtgat gatcgcaatg gacaggctgc agcgcgaagt cagtgcgttc       240
     ccgtgggact ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page