(data stored in ACNUC7421 zone)

EMBL: CP000283.PE136

CP000283.PE136       Location/Qualifiers
FT   CDS_pept        complement(155814..156233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0136"
FT                   /product="protein of unknown function DUF1236"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37376"
FT                   /db_xref="GOA:Q13EW3"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW3"
FT                   /protein_id="ABE37376.1"
FT                   /translation="MMNRFAGAAVVVLSLATPSIVNAQGVPGGVERGAREGERAAGPVG
FT                   AVVGGTIGGVVGGVAGILGVDDRPRFRSYVVDQRRPSYSYREDVRVGAVLPADGVTYYE
FT                   VPDQFSAARDYRYTVVNGRTVLVEPRTRRIVEIIE"
     atgatgaatc gttttgccgg cgccgctgtc gtcgttctgt cacttgccac gccttcaatc        60
     gtcaacgccc agggcgtccc gggtggcgtc gagcgcggcg cgcgtgaggg cgagcgcgcg       120
     gccggtccgg tcggtgcggt cgtcgggggt accatcggcg gtgtcgttgg cggagtcgcc       180
     ggcatcctcg gcgtcgacga tcgtccgcgc ttccgcagct atgtggtcga tcagcgccgt       240
     ccgtcctact cctatcgcga agacgttcgc gtcggcgccg tgttgcctgc cgacggcgtg       300
     acttactacg aggttccgga tcagttcagc gcagcgcgcg attatcgcta cacggtggtc       360
     aacggccgca ccgttctggt cgagccgcgc acccgtcgaa tcgtcgagat catcgagtaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page