(data stored in ACNUC7421 zone)

EMBL: CP000283.PE14

CP000283.PE14        Location/Qualifiers
FT   CDS_pept        complement(18758..19339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37254"
FT                   /db_xref="InterPro:IPR024220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F85"
FT                   /protein_id="ABE37254.1"
FT                   /translation="MSERKTIGFGVPNDIDPHHFTVEIPAVRANPVIITEHFGLSGGAN
FT                   GLPDSIERCRLPQEAWNAIRRELERVFNERLKEKKLTAARWKTGKNPVERLLGRELCVL
FT                   AWGVETAPKDTIPNAIRNWGAFKPEERWWLFAMAASLTGTSQDVDIGWRKAIRIALTET
FT                   PTGEEVVAIRSKRPKSEGDRPRLPLFDDVK"
     gtgagcgagc gtaaaacgat cggatttggc gtcccgaacg acatcgatcc ccaccacttc        60
     acggtggaga tccctgccgt ccgggcaaat ccggtcatca tcaccgagca cttcggcctc       120
     tccggcggcg cgaacgggct gccggattcg atcgaacgtt gccggcttcc gcaggaagcc       180
     tggaacgcga ttcgcagaga gctcgagcgc gtcttcaacg aacgcctcaa ggaaaagaag       240
     ctgaccgccg ctcggtggaa gaccggcaag aacccggtcg aacgcctgct cgggcgcgaa       300
     ctctgcgtgc tggcgtgggg cgtcgaaacg gctccgaagg acaccatccc gaacgcgatc       360
     cggaattggg gcgcattcaa gccagaggaa cgctggtggt tgttcgcgat ggcggcgtcg       420
     ctcaccggga cttcgcagga tgtcgacatc ggttggcgca aggccattcg aatcgccctg       480
     acggaaacgc cgaccgggga agaagtcgtc gcaatccgct ccaagaggcc gaagtccgaa       540
     ggcgatcgcc cgcgcttgcc cctgttcgat gacgtaaagt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page