(data stored in ACNUC7421 zone)

EMBL: CP000283.PE142

CP000283.PE142       Location/Qualifiers
FT   CDS_pept        160993..161466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37382"
FT                   /db_xref="GOA:Q13EV7"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV7"
FT                   /protein_id="ABE37382.1"
FT                   /translation="MSDTMYDVFKFLHVVGVVVLVGNVTITAFWKAFSDLTRDPKIVAH
FT                   AQRGVTVSDLIFTLLGIVLVMVGGYGAAIVKDVPLFSSFWLVAGQILFAISGMMWLGIL
FT                   VPLQIRQARLARSFADGSDIPERYWRDTRTWLIWGIIATVPLVAAIFVMVVKF"
     gtgtctgaca cgatgtacga cgtcttcaaa ttcctccacg ttgtcggcgt ggtcgtgctg        60
     gtcggcaacg tcacgatcac cgcgttctgg aaggccttct ccgatctcac ccgcgatccg       120
     aagatcgtcg cccacgccca gcgcggcgtc accgtgtcgg atctcatctt caccttgctc       180
     ggcatcgtgc tggtgatggt cggcggctat ggcgcggcga tcgtcaagga cgtcccgctg       240
     ttttcctcgt tctggctggt cgccgggcag atcctgttcg ccatctccgg aatgatgtgg       300
     ctcggcatcc tggtcccgct gcagatccgg caggcgcggc tcgcccgcag cttcgccgac       360
     ggcagcgaca tcccggagcg ctactggcgc gacacccgga cctggctgat ctggggcatc       420
     atcgccacgg tgccgctggt cgctgcgatc ttcgtgatgg tggtgaagtt ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page