(data stored in ACNUC7421 zone)

EMBL: CP000283.PE144

CP000283.PE144       Location/Qualifiers
FT   CDS_pept        161969..162517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV5"
FT                   /protein_id="ABE37384.1"
FT                   /translation="MKRRRNFGGRRRLPKVDGETNHNGGLSAPDEKTAALARAFDSAWE
FT                   RFIATEGAEADTDANRKRLASKIVALSRAGEADEDRLAQSGLIHLSVLAEAARLGSQPP
FT                   APTNGIGTSQQATHAQAFSPQTVAAMSAALEQCVETLPLQTPSSALQFLSARILEQASR
FT                   GEHDPERLSRHALEALRNR"
     atgaagcggc ggcggaactt cgggggacgc cgacggttgc cgaaggtgga cggcgaaacc        60
     aaccataacg gcggcctgtc cgccccggac gagaagacgg cggcgctggc gcgcgccttc       120
     gacagcgcgt gggaacggtt catcgcgacc gagggcgccg aagccgacac cgatgccaac       180
     cgcaaacggc tggcgtcgaa gatcgtggcg ctgtcgcgcg ccggcgaggc cgatgaagac       240
     aggctggcgc agtccggctt gatccatctg tcggtgctgg ccgaggccgc gcgtctcggc       300
     agccagccgc ccgcgcccac caacggaatc ggcacatcac agcaggcgac gcacgcgcag       360
     gcgttcagcc cgcagaccgt cgcggcgatg tcggcggcgc tcgagcaatg cgtcgaaacg       420
     ctgccgctgc agacgccgtc gagcgcactg caattcctgt ccgctcgaat tctcgaacag       480
     gcctcgcgcg gcgagcacga tccggagcgg ctcagccgcc acgcgctgga agccctgcgc       540
     aatcgctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page