(data stored in ACNUC7421 zone)

EMBL: CP000283.PE152

CP000283.PE152       Location/Qualifiers
FT   CDS_pept        complement(170705..171424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0152"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37392"
FT                   /db_xref="GOA:Q13EU7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU7"
FT                   /protein_id="ABE37392.1"
FT                   /translation="MPANSDEQLSQSGFAEAPHYHGHRERLRERFREAGADALSDYELL
FT                   EMVLFRALPRRDVKPLAKALIARFGSFAETMHAPEPRLREVSGLGEAAITEIKLVAAAA
FT                   ARVTKGQVKSRTVLSSWSAVIDYCRTTMAFADKEQFRILFLDKRNQLIADELQQVGTVD
FT                   HTPVYPREIVKRALELSATAVIMVHNHPSGDPTPSQADIQMTRTIVAIAEPLGVSVHDH
FT                   IIVGKNGHASLKGLKLI"
     atgccagcaa acagcgacga gcaattgagc cagagcggct tcgccgaggc gccgcattat        60
     cacggccatc gcgagcggct gcgcgagcgc tttcgcgagg ccggcgccga cgcgctgtcg       120
     gactatgaac tgctcgagat ggtgctgttc cgcgcgctgc cgcgccgcga cgtcaagccg       180
     ctggcgaagg cgctgatcgc gcgattcggc tcgttcgccg aaacgatgca cgcgcccgag       240
     ccgcggctgc gcgaagtctc agggctcggc gaggcggcga tcaccgagat caagctggtc       300
     gcggcggcgg cggcgcgcgt caccaagggg caggtcaaga gccgcaccgt gctgtcgtca       360
     tggtcggcgg tgatcgatta ctgccgcacc acgatggcgt tcgccgacaa ggagcaattc       420
     cgcatcctgt ttctcgacaa gcgcaatcag ctgatcgccg acgaattgca gcaggtcggc       480
     accgtcgatc atacgccggt gtatccgcgc gagatcgtca agcgcgcgct ggaactgtcg       540
     gcgacggcgg tgatcatggt gcacaaccac ccttcgggcg atccgacgcc gtcgcaggcc       600
     gacatccaga tgacccggac gatcgtcgcg atcgccgaac cgctcggcgt ctccgtgcac       660
     gatcacatca tcgtcggcaa gaacggccac gccagtttga aggggctgaa gctgatctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page