(data stored in ACNUC7421 zone)

EMBL: CP000283.PE154

CP000283.PE154       Location/Qualifiers
FT   CDS_pept        173763..174749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37394"
FT                   /db_xref="GOA:Q13EU5"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EU5"
FT                   /protein_id="ABE37394.1"
FT                   /translation="MAPRANWKGFLRLSLVTCPVALFPATSDAEKISFNQINRKTGNRI
FT                   KYTKVDADTGEEVSSDDIMKGYKVDTDSYIEITKDELDAIALESTRTIEIDQFVPKSEI
FT                   DDLYLVRPYYIVPDGKVGHDAYAVIRETIRTMDRVALARVVLTNREHVIALEARDNGLM
FT                   GMLLRYPYEVRDASEYFDDIQDVKITKDMLDLARHIVEQRSGHFEPDKFEDHYEAALTE
FT                   LINQKRNGQPIAPKARPRGDNVVDLMDALRKSLGGAKPAPAAGKAASAEKPAAKPARTK
FT                   KRKTAPGQKEMLLPISGAKSAAAKQDAGKAKKPARSSTASSKARKTG"
     atggcccccc gcgccaattg gaaaggcttt ttgcggcttt cgctggtgac ctgtccggtg        60
     gcgctgtttc ccgccacctc ggacgctgag aagatcagct tcaaccagat caaccgcaag       120
     accggcaacc ggatcaaata caccaaggtc gacgccgaca ccggcgagga ggtctcctcc       180
     gacgacatca tgaagggcta caaggtcgat accgacagct acatcgagat caccaaggat       240
     gagctcgatg cgatcgcgct ggaatcgacc cggacgatcg agatcgatca gttcgtgccg       300
     aaatcggaaa tcgacgatct gtacctggtg cgaccgtact acatcgtccc cgatggcaag       360
     gtcggacacg acgcctatgc ggtgatccgc gagaccatcc gcacgatgga ccgggtggcg       420
     ctggcgcggg tggtgctgac caatcgcgag catgtcatcg cgctggaggc gcgcgacaac       480
     ggcctgatgg ggatgctgct gcgctatccc tacgaggtgc gcgatgcgtc cgagtatttc       540
     gacgacatcc aggacgtcaa gatcaccaag gacatgctcg acctcgcccg tcacatcgtc       600
     gaacagaggt ccggccattt cgagcccgac aaattcgagg atcactacga ggccgcactg       660
     accgaactga tcaaccagaa gcgcaacggc cagccgatcg cccccaaggc gcgcccgcgc       720
     ggcgacaatg tcgtcgacct gatggacgcg ctgcgcaaga gtctcggcgg cgccaagccc       780
     gcaccggcgg ccgggaaagc cgcctctgcc gagaagcccg ccgcaaaacc cgcaagaacg       840
     aaaaagcgca agaccgctcc cggccaaaag gaaatgctgc tcccgatcag cggcgccaaa       900
     tccgccgccg caaagcaaga cgccggcaag gccaagaagc ccgcgcgcag ttcgacagcg       960
     agtagcaagg cgcggaaaac gggatag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page