(data stored in ACNUC7421 zone)

EMBL: CP000283.PE160

CP000283.PE160       Location/Qualifiers
FT   CDS_pept        complement(183064..184008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37400"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET9"
FT                   /protein_id="ABE37400.1"
FT                   /translation="MGVVLDAIGKVIANYLQKEEPGYEPFTPSDPDHLRSIMQPGDVLL
FT                   VEGNARISGIIKYLTQSTWSHAALYVGPIDGATEPDGEPHVLIEANIGEGVSSSPLSRH
FT                   LSYHTRICRPVGLSHEDRHTVCRYAINRIGFGYDTKNIIDLMRYLVPLPVPQRWRRRMI
FT                   ALGSGDPTKIICSALIAQAFDSVRYPILPKITRAGSRKARREILHIRDSSLYMPRDFDI
FT                   SPYFEVVKPTIINGFDYTALHWADKQKPLAEVAGPFNTFQDDLENASSFAPETIDAEAP
FT                   AMGGANQAPAVILSRTHWQHPEPRTLAPLEASS"
     atgggcgttg tgctcgatgc catcggcaag gtcattgcca actacctgca aaaggaagag        60
     ccgggctacg agccgttcac gccgagcgat cctgatcacc tgcgcagcat catgcagccc       120
     ggcgacgtgc tgctggtcga aggcaatgcg cggatctccg gcatcatcaa atacctcacg       180
     cagtcgacct ggtcgcacgc cgcgctgtat gtcgggccga tcgacggcgc gaccgagccc       240
     gacggcgagc cgcatgtgct gatcgaggcc aatatcggcg agggcgtctc ctcgtcgccg       300
     ctgtcgcggc atctgagcta tcacacccga atctgtcgcc cggtcggcct gtcccacgag       360
     gaccgccata cggtgtgccg ctacgcgatc aaccggatcg gcttcggcta cgacaccaag       420
     aacatcatcg atctgatgcg ctatctggtt ccgctcccgg tgccgcaacg ctggcgccgg       480
     cggatgatcg cgctcggctc cggcgatccg accaagatca tctgctcggc gctgatcgcg       540
     caggcgttcg actcggtgcg ctacccgatc ctgccgaaga tcacccgcgc cggcagccgc       600
     aaggcgcgcc gcgagatcct gcacatccgc gattcgtcgc tgtacatgcc gcgcgacttc       660
     gacatctcgc cctatttcga agtggtcaag ccgaccatca tcaacggctt cgactacacg       720
     gcgctgcatt gggccgacaa gcagaagccg ctcgcggagg tggcgggccc gttcaacacg       780
     tttcaagacg acctggaaaa tgcgtcgtcg ttcgctcctg aaacgattga cgcggaagcg       840
     ccggcaatgg gcggcgcaaa tcaggcgccg gccgtgatcc tgagccgcac gcactggcaa       900
     catccagagc cccgcacgct cgcgcccctc gaagcgtcat cctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page