(data stored in ACNUC7421 zone)

EMBL: CP000283.PE163

CP000283.PE163       Location/Qualifiers
FT   CDS_pept        complement(188553..189137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0163"
FT                   /product="protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37403"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET6"
FT                   /protein_id="ABE37403.1"
FT                   /translation="MMKALSSPHDALPRPLAGEGWGEGDTGTELAMDDPKQPSWNVSPS
FT                   LRRHARELRKTSTDAERLMWSALRDKQLNGFSFRRQVPIGPFIADFACHSVKLVVEIDG
FT                   GQHFSDDAERADASRTALIEARGFRIVRFSNAEVMSNRDGVLQSIAAELAASAPTPTLP
FT                   RKRERERAKRAAKQRPEQIDSKQRPAAGDAD"
     atgatgaaag ccctctcatc gccgcacgac gcgctccctc gcccgcttgc gggagagggt        60
     tggggtgagg gcgacacggg cacggagctt gcgatggacg atccgaagca accgagctgg       120
     aatgtatctc cgagcctgcg ccgccacgcg cgcgagttgc gcaagacatc gaccgacgcc       180
     gagcggctga tgtggtcggc gctgcgcgac aagcagctca acggtttctc gtttcgccgt       240
     caggtgccga tcgggccgtt catcgcggac ttcgcctgcc attcggtcaa gctcgtcgtc       300
     gagatcgacg gcggccagca tttttccgac gacgccgagc gcgccgacgc gtctcgcacg       360
     gcgctgatcg aggcgcgcgg atttcggatt gtccggttca gcaatgccga ggtgatgagt       420
     aatcgcgacg gcgtgctgca gagcattgcc gctgagcttg cggcaagtgc ccccaccccg       480
     accctccccc gcaagcggga gagggagcgc gccaagcgcg cggccaagca gcgccctgaa       540
     cagatcgatt ccaagcagcg ccctgcggcg ggcgatgcgg actaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page