(data stored in ACNUC7421 zone)

EMBL: CP000283.PE164

CP000283.PE164       Location/Qualifiers
FT   CDS_pept        complement(189275..190357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0164"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37404"
FT                   /db_xref="GOA:Q13ET5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ET5"
FT                   /protein_id="ABE37404.1"
FT                   /translation="MSNLENLQTQILADIAASSDEAALEAVRVGALGKKGSISALLATL
FT                   GKMDPEQRKTEGAAINLAKEAVTQALTARRDLLKAAALDAKLAAETIDVTLPLREPLAE
FT                   QGRIHPLSQVWDELTAIFADMGFAIAEGPDIETDDNNFTRLNFPEGHPAREMHDTFYFN
FT                   PKEDGSRLLLRTHTSPVQVRTMLSQRPPIRVICPGRTYRSDSDQTHTPMFHQVEGLVID
FT                   KGSHLGHLKWILAEFCKAFFEVDNVNMRFRPSFFPFTEPSLEVDIQCRRGNGEIRFGEG
FT                   EDWLEILGCGMVHPNVLTACGIDPEVYQGFAWGMGIDRIAMLKYGMADLRQLFEADSRW
FT                   LNHYGFKPLDIPSLAGGLSS"
     atgtccaatc tcgaaaacct gcaaacccag atcctcgccg atatcgccgc ttcgtccgac        60
     gaagccgcgc tcgaagcggt gcgtgtcggc gcgctcggca agaagggctc gatctcggcg       120
     ttgctcgcga cgctcggcaa gatggacccc gagcagcgca agaccgaagg cgcggcgatc       180
     aacctcgcca aggaggcggt cacgcaggcg ctgaccgcgc ggcgcgatct gctcaaggcc       240
     gcagcgctcg acgccaagct cgccgccgag accatcgacg tgacgttgcc gctgcgtgag       300
     ccgctggcgg agcagggccg gattcatccg ctcagccagg tctgggacga actcaccgcg       360
     atcttcgccg atatgggctt tgcgatcgcc gaaggtccgg acatcgagac cgacgacaac       420
     aacttcaccc ggctgaactt ccccgagggc catccggccc gcgagatgca cgacacgttc       480
     tacttcaatc cgaaggaaga cggctcgcgc ctgctgctgc gcacccacac ctcgccggtg       540
     caggtgcgca ccatgctgtc gcagcgcccg ccgatccggg tgatctgccc cggccgcacc       600
     tatcgcagcg actcggacca gacccatacg ccgatgttcc accaggtcga aggtctggtg       660
     atcgacaagg gcagccatct cggccatctg aaatggatcc tcgccgagtt ctgcaaggcg       720
     ttcttcgagg tcgacaacgt caacatgcgg ttccggccgt cgttcttccc gttcaccgag       780
     ccgtcgctgg aagtcgacat ccagtgccgc cgcggcaatg gtgagatccg gttcggcgag       840
     ggcgaggact ggctggagat tctcggctgc ggcatggtcc accccaacgt gctgaccgcc       900
     tgcggcatcg atcccgaagt gtatcagggc ttcgcctggg gcatgggcat cgaccgcatc       960
     gcgatgctga aatacggcat ggccgatctg cggcaattgt tcgaggccga ttcgcgctgg      1020
     ctcaatcact acggcttcaa gccgctggat atcccgtcgc tggcgggggg attgagttcg      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page