(data stored in ACNUC7421 zone)

EMBL: CP000283.PE175

CP000283.PE175       Location/Qualifiers
FT   CDS_pept        199311..200081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37415"
FT                   /db_xref="GOA:Q13ES4"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES4"
FT                   /protein_id="ABE37415.1"
FT                   /translation="MASVQTAAYHTSMEARFAAAARHSRLVRTLRVAVPLVVALSLAAI
FT                   LAISIFNPFRLLSKLPIDIGDLVVSGTKITMESPHLAGFTNDGRPYEMWARSATQDLTS
FT                   QDHVDLHTLRAKVVSDDQSTVLIQARDGKFNTKAQLLNLQKDVYLRTSTGSEAWMTQAD
FT                   IDMGKGNVSSDEPVDVKWLGGTLRGQRLRITEKGDVIRFEGGVVMNLDNANLPEPAEET
FT                   DTRAQPAPAAVPNADAAAKSKSSQPGQRREVNRP"
     gtggcttcgg ttcagacggc ggcctatcac accagcatgg aggcgcgctt cgcggcggcg        60
     gcgcgccata gccggctggt gcgaacgctg cgggtcgcgg tgcctctggt ggtggcgctg       120
     tcgctcgctg cgatcctcgc catctcgatc ttcaacccgt tccgcctgct gtcgaaactg       180
     ccgatcgaca ttggcgatct ggtggtgtcc ggaaccaaga tcacaatgga gtcgccgcat       240
     cttgcgggct tcaccaatga cgggcggccc tatgagatgt gggcgcgatc ggcgacccag       300
     gatctcacca gccaggacca tgtcgatcta catacgctgc gggcgaaggt ggtcagcgac       360
     gaccagtcca ccgtgctgat ccaggcccgc gacggcaagt tcaacaccaa ggctcagctt       420
     ttgaacctgc agaaggacgt gtatctgcgc acatcgaccg gcagcgaggc gtggatgact       480
     caggccgaca tcgatatggg caaaggcaat gtctcgtctg acgagccggt cgacgtcaaa       540
     tggctcggcg gcacgttgcg cgggcagcgg ctgcgcatta ccgagaaggg cgacgtgatc       600
     cgattcgagg gcggggtggt gatgaacctg gacaacgcca atctgccgga gcccgccgag       660
     gagaccgaca cgcgtgcgca gcccgctccg gccgcggttc cgaacgccga cgcggcggcc       720
     aaatcgaagt cgtcgcaacc gggccaacgc cgcgaagtga accgcccatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page