(data stored in ACNUC7421 zone)

EMBL: CP000283.PE176

CP000283.PE176       Location/Qualifiers
FT   CDS_pept        200078..200743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0176"
FT                   /product="OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37416"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES3"
FT                   /protein_id="ABE37416.1"
FT                   /translation="MTNARCLLARRKLLAIAGAAFLAGSANLSGALAQSAVQGVPNAMQ
FT                   GFSQNRDQPIQIESDTLEVRDKKKEATFTGSVKVVQGDTTMTSKTLVVFYDQDQSETSA
FT                   KQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQKDQVVTGDSAVFDTKTNLVTMLGSV
FT                   VLTQGKNVVRGDRLLVDMTTGVSRVESNSGRVQGLFQSSGSGSGAPLGIGPPPAGQKK"
     atgacaaacg cccgttgcct tctcgctcgt cgcaaactgc ttgcgatcgc cggcgcagcg        60
     tttctggccg gctcggcgaa cttgtcgggc gcgttggcgc aaagcgccgt gcaaggcgtg       120
     ccgaacgcga tgcagggctt ctcgcagaat cgcgatcagc cgatccagat cgaatccgac       180
     acgctggagg ttcgcgacaa aaagaaagag gcgaccttca cgggcagtgt caaggtggtc       240
     cagggcgaca ccaccatgac ctcgaagacc ctcgtggtgt tctacgatca ggatcagtcc       300
     gagacctccg ccaaacaagc caagcgcaag gcgatgcccg cagcagcgcc gggtcccggc       360
     ggcacgtcgt cgattcgccg gctcgaggcc aagggcaatg tggtggtcac ccagaaggat       420
     caggtggtga ccggcgacag cgcggtgttc gataccaaga ccaatctggt gacgatgctg       480
     gggagcgtgg tgctcactca gggcaagaac gtggtgcgcg gcgatcggct gctggtcgac       540
     atgaccaccg gcgtgtcgcg cgtcgaatcc aacagcggcc gggtgcaggg cctgtttcag       600
     tcgtcaggca gcggatcagg cgccccgctc ggcatcgggc cgcccccagc gggccagaag       660
     aaatga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page