(data stored in ACNUC7421 zone)

EMBL: CP000283.PE179

CP000283.PE179       Location/Qualifiers
FT   CDS_pept        203618..204226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0179"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37419"
FT                   /db_xref="GOA:Q13ES0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES0"
FT                   /protein_id="ABE37419.1"
FT                   /translation="MTIRVSGKSISVGEALRGRVSERTEEVLRKYFDGNYSGHITLSKD
FT                   GFGFRTDCSLHLDSGITLEAESNAADAYVSADQALLQIEKRLRRYKSRLKDRSSRKAHA
FT                   EATALAELTAPVDMPSYVIEAPGDEEHHEDAYNPVIIAEATTAMKRLSVSEAVVELDLT
FT                   GAPVLIFLHGGSGRVNIIYRRADGNIGWIDPPSLNGAAA"
     atgaccatcc gggtctccgg caagagcatc agcgtcggcg aagcgctgcg cggccgtgtc        60
     agcgagcgca ccgaagaggt gttgcgcaaa tatttcgatg gcaattattc gggccatatt       120
     acgctgagca aggacggctt tggattccgc accgactgct cgctgcatct cgattccggc       180
     atcacgctgg aagccgagtc gaacgctgcc gatgcttatg tcagcgccga tcaggcgctg       240
     ctgcaaatcg agaagcggct gcgccgctac aagagccggc tgaaggatcg ctcgtcccgc       300
     aaggcccatg ccgaggcgac cgccctggcc gaactgactg cgccggtcga catgccgagc       360
     tacgtcatcg aggcgcccgg cgacgaggag catcacgagg acgcgtataa tccggtgatc       420
     atcgccgagg ccaccaccgc catgaagcgt ctgtcggtca gcgaagccgt ggtggagctc       480
     gacctcaccg gcgcgccggt gctgatcttc cttcacggcg gctccggccg tgtgaacatc       540
     atctaccgtc gcgccgacgg caatatcggt tggatcgatc cgccgtcgct gaacggcgcc       600
     gcggcctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page