(data stored in ACNUC7421 zone)

EMBL: CP000283.PE185

CP000283.PE185       Location/Qualifiers
FT   CDS_pept        complement(208316..209230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37425"
FT                   /db_xref="GOA:Q13ER4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER4"
FT                   /protein_id="ABE37425.1"
FT                   /translation="MTAVRAGRSRIMQKQSVFHSKFLPYMLVLPQLAVVLVFFYWPAVQ
FT                   AVIQSFLLQDAFGLSTTFVWFDNYRELLSDPDYFSAILRTFLFSVAIALSSLSLALLLA
FT                   VMADRPLRGSTFYRTLLIWPYAVAPPVVGVLWVFMLNPSLGVIAHGLRAIGIDWNPLLD
FT                   GNQAATLIILAAAWKQISYNFLFFLAGLQAIPSSVIEAAAIDGARPMRRFWTIIFPLLS
FT                   PTIFFLIVVNIVYAFFETFGIIDTMTRGGPAKATETLVYKVYSDGLLGGNLGSSAAQSV
FT                   ILMGIVIALTAFQFRFVERKVNY"
     atgacggcag tgagggcggg gcggtcgagg atcatgcaga agcagtccgt cttccactcg        60
     aaattcctac cctatatgct ggtgctgccg cagctcgcgg tggtgctggt gttcttctat       120
     tggccggcgg tgcaggcggt catccagtcg ttcctgttgc aggacgcgtt cggcttgtcg       180
     accaccttcg tatggttcga caattatcgc gagctactga gcgacccgga ctatttcagc       240
     gcgattctcc gcaccttcct gttttcggtt gcgatagcgc tgtcgtcgct gtcgctggcg       300
     ctgttgctcg cggtgatggc cgacaggccg ctgcgcggct cgaccttcta tcgcacgctg       360
     ttgatctggc cctacgcggt cgcgccgccg gtggtcggcg tgctctgggt gttcatgctc       420
     aacccctcgc tcggcgtgat tgctcacggg ctgcgcgcga tcggaatcga ctggaatccg       480
     ctgctcgacg gcaatcaggc cgcgaccctg atcatcctcg ccgcagcctg gaagcagatc       540
     tcctacaact tcctgttctt cctcgccggg ctgcaggcga tcccgtcgag cgtgatcgag       600
     gccgcggcga tcgacggcgc ccggccgatg cgacggttct ggaccatcat cttcccgttg       660
     ctgtcgccga cgatcttctt tctgatcgtc gtcaacatcg tctacgcgtt cttcgaaact       720
     ttcggcatca tcgacaccat gacccgcggc ggcccggcca aggccaccga aacgctggta       780
     tacaaggtct atagcgacgg cctgctcggc ggcaatctcg gcagttcggc ggcgcagtcg       840
     gtgatcctga tgggcatcgt catcgcgctg accgcgttcc agttccgctt cgtcgagcgc       900
     aaggtgaatt actga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page