(data stored in ACNUC7421 zone)

EMBL: CP000283.PE191

CP000283.PE191       Location/Qualifiers
FT   CDS_pept        215116..215754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0191"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37431"
FT                   /db_xref="GOA:Q13EQ8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ8"
FT                   /protein_id="ABE37431.1"
FT                   /translation="MIIAIDGPAASGKGTLGKRLAAHYGFRHLDTGVIYRAVAKALLDG
FT                   GADLTDEARAVAAARKLDPGIFGDPALKSQTVGDAASVISAYAPLREALVSFQRQFAAD
FT                   PPGAVLDGRDIGTVICPDADVKIFVIADPVVRARRRTLEALARGEAADEARVLADILKR
FT                   DERDRNRSAAPLTQAPDAVLLDNSNLDIEGGVRAAIDIVEAVRAGRRRV"
     atgatcatcg ccatcgacgg accggccgct tccggcaagg gcacgctcgg caagcggctc        60
     gccgcccact atggctttcg gcaccttgat accggcgtaa tctaccgtgc ggtcgccaag       120
     gcgctgctgg acgggggcgc cgacctgacc gacgaagccc gggctgtcgc cgccgcgcgc       180
     aagctcgatc ccggcatttt cggcgacccc gcgctcaaga gccagaccgt tggcgacgcc       240
     gcctcggtga tttcggccta tgccccgctc cgcgaggcgc tggtcagctt tcaaaggcaa       300
     ttcgccgccg atccgccggg cgccgtgctg gacgggcgcg atattgggac tgtgatttgc       360
     cccgacgcag acgtgaagat ctttgtcatc gccgatcccg tggtgcgcgc ccgccgccgg       420
     acgctggagg cccttgcacg cggcgaggct gccgacgagg cgcgagtcct cgctgacatc       480
     ctcaagcgcg acgagcgcga caggaaccgc agcgcagcgc cgctgacgca ggcgcccgat       540
     gcagtcttgc tcgacaattc caatttggat atagaaggcg gcgtccgggc cgccatcgat       600
     attgtcgagg ccgttcgagc gggccggcgt cgggtctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page