(data stored in ACNUC7421 zone)

EMBL: CP000283.PE192

CP000283.PE192       Location/Qualifiers
FT   CDS_pept        216049..217746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0192"
FT                   /product="SSU ribosomal protein S1P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37432"
FT                   /db_xref="GOA:Q13EQ7"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ7"
FT                   /protein_id="ABE37432.1"
FT                   /translation="MASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGIVVAIEKDMA
FT                   VIDVGLKTEGRVALREFAGPGRESELKVGDTVEVFLDRIENALGEAVLSRDKARREESW
FT                   GKLEKAFQGNEKVFGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVAPLMNNSQPF
FT                   QILKMDRRRGNIVVSRRTVLEETRAEQRQELVQNLEEGQVIDGVVKNITDYGAFVDLGG
FT                   IDGLLHVTDIAWRRVNHPTEVLTIGQTVKVKIIKINHETHRISLGMKQLLDDPWQGIEA
FT                   KYPLNARFTGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNMHPGKIVSTSQEVDVQ
FT                   VLEVDSVKRRISLGLKQTMRNPWEVFVEKYPVGSTVEGEVKNKTEFGLFLGLDGDVDGM
FT                   VHLSDLDWKQPGEQVIDNFKKGDMVKAVVLDVDVEKERISLGVKQLEGDPFAEPGDVKK
FT                   GAIVTCEVLDVKESGIDVQIVGTDFATFIKRSELARDRNDQRSDRFAVGEKVDARVIQF
FT                   DKKARKVQVSIKALEVAEEKEAIAQYGSSDSGATLGDILGTALKQRDK"
     atggcttcga ctgatactta caacccgacc cgcgacgatt tcgccgcgat gctcgacgag        60
     tcctttgccg gcggcaatct gcaggaaagc tcggtcatca agggcatcgt cgttgcgatc       120
     gaaaaggaca tggccgtcat cgacgtcggc ctgaagaccg aaggccgcgt ggcactgcgc       180
     gaattcgcag gacccggccg tgaaagcgaa ttgaaggtcg gcgacaccgt cgaagtgttc       240
     cttgaccgga tcgaaaatgc gctcggcgaa gccgttctgt cgcgcgacaa ggcgcgccgc       300
     gaagagagct ggggcaagct cgagaaggcc ttccagggca acgagaaggt gttcggcgtc       360
     atcttcaacc aggtcaaggg cggcttcacg gtcgacctcg acggcgccgt ggcgttcctg       420
     ccgcgctcgc aggtcgacat ccgtccgatc cgcgacgtcg cgccgctgat gaacaactcg       480
     cagccgttcc agatcctcaa gatggatcgc cgccgcggca acatcgtggt gtcgcgccgc       540
     acggttctcg aagagacccg cgccgagcag cgccaggagc tggtgcagaa cctcgaagag       600
     ggtcaggtga tcgacggcgt cgtcaagaac atcaccgatt acggtgcgtt cgtcgacctc       660
     ggcggcatcg acggcctgct gcacgtcacc gacatcgcct ggcgccgggt caatcacccg       720
     accgaggtgc tgacgatcgg ccagaccgtc aaggtcaaga tcatcaagat caaccacgag       780
     acccaccgca tctcgctcgg catgaagcaa ctgctggacg atccgtggca gggcatcgag       840
     gcgaagtacc cgctgaacgc gcgcttcacc ggccgcgtca ccaacatcac cgactacggc       900
     gcgttcgtcg agctggagcc gggcatcgaa ggcctgatcc acgtctcgga gatgtcgtgg       960
     accaagaaga acatgcaccc cggcaagatc gtttcgactt cgcaggaagt cgacgtgcag      1020
     gtgctcgagg tcgattcggt caagcgccgg atttcgctcg gcctcaagca gaccatgcgc      1080
     aatccgtggg aagtgttcgt cgagaagtac ccggtcggtt cgaccgtcga aggcgaagtc      1140
     aagaacaaga ccgagttcgg tctgttcctc ggcctcgacg gcgacgtcga cggcatggtc      1200
     catctctcgg acctcgactg gaagcagccg ggcgagcagg tgatcgacaa cttcaagaag      1260
     ggcgacatgg tcaaggccgt ggtgctcgac gtcgatgtcg agaaggagcg catctcgctc      1320
     ggcgtcaagc agctcgaagg cgaccccttc gccgagccgg gcgacgtcaa gaagggcgcg      1380
     atcgtgacct gcgaagtgct ggacgtgaag gaatccggga tcgacgtgca gatcgtcggc      1440
     accgacttcg cgaccttcat caagcgctcg gagctggcgc gcgaccgcaa cgatcagcgc      1500
     agcgaccgct tcgcggtcgg tgagaaggtc gacgcccgcg tgatccagtt cgacaagaag      1560
     gcccgcaagg tccaggtgtc gatcaaggcg ctcgaagtcg ccgaagagaa ggaagccatc      1620
     gcgcaatacg gctcgtccga ttcgggcgcg acgctgggcg acatcctcgg caccgcgctc      1680
     aagcagcgcg acaagtaa                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page