(data stored in ACNUC7421 zone)

EMBL: CP000283.PE195

CP000283.PE195       Location/Qualifiers
FT   CDS_pept        219442..219855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37435"
FT                   /db_xref="GOA:Q13EQ4"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ4"
FT                   /protein_id="ABE37435.1"
FT                   /translation="MRGKASENDMQKFLTALVLIPLGLIFIVFAVANRHLVTVSFDPLE
FT                   PLNPMGTVQMPLFVLIIGVAILGVIAGGVATWVRQRHWRRAARRHQAEAIQAQTQLANL
FT                   RASVVTPAQSEPKRLLLGQGSAAGRRDKTSAAL"
     ttgcggggca aggcgagcga gaacgacatg cagaagtttt tgacggccct ggtgctgatc        60
     ccgctcggat tgattttcat cgtgttcgcg gtcgccaacc gccatctcgt cacggtgtcg       120
     ttcgacccgc tcgagccgct caatccgatg ggcacggttc aaatgccgct gttcgtcctg       180
     atcatcggcg tggcgatcct cggcgtgatc gccggcggcg tcgcgacctg ggttcgccag       240
     cggcattggc gccgcgcggc acggcggcat caggccgagg ccatccaggc ccaaacgcag       300
     ctcgcgaatt tgcgcgctag cgtcgtcacc cctgcccaga gcgagccgaa gcggctgttg       360
     ctgggacagg gttccgcggc cggcaggcgc gacaagacca gcgcggcgtt gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page