(data stored in ACNUC7421 zone)

EMBL: CP000283.PE199

CP000283.PE199       Location/Qualifiers
FT   CDS_pept        222727..223695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0199"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37439"
FT                   /db_xref="GOA:Q13EQ0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ0"
FT                   /protein_id="ABE37439.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQF
FT                   VIPGSNYHMRMGALARLRSVFDNETWYDVALPEVTADPLKFRDERKYADRIKDARTKTG
FT                   AHDAVKVGYGKLEGLGVVAAVQDFDFMGGSLGMAAGEAIIRGLELAVEKHAPFIMFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREAGLPYIVVLTNPTTGGVTASYAMLGDIQLAEP
FT                   GALIGFAGARVIEQTIREKLPDGFQRAEYLRDHGMVDMVVHRHELRPTLARLCRILTKT
FT                   PLPAVEEIAASDDAAQDAEAAAATEIVVTPPEAPSPTAPQA"
     atgaactggt tgaccaacgt cgtccgtccg aagatccgca acatcctgcg gcgcgagact        60
     ccggagaatc tctggatcaa atgtccggat accgggcagt tggtgttcta caaggacgtc       120
     gagcagaacc agttcgtcat tcccggctcg aactatcaca tgcgcatggg cgcgttggcg       180
     cggctgcggt cggttttcga caacgagacc tggtatgacg tcgcgcttcc ggaagtcacc       240
     gccgacccgc tgaaattccg ggacgagcga aaatatgccg accgcatcaa ggatgcccgc       300
     accaagaccg gcgcccatga cgcggtcaag gtcggctacg gcaagctcga aggcctcggc       360
     gttgtcgccg ccgtgcagga cttcgatttc atgggcggct cgctcggcat ggcggccggc       420
     gaagcgatca tccgtggact ggagcttgcg gtcgagaaac acgcgccctt catcatgttc       480
     gcggcctccg gcggcgcgcg gatgcaggaa ggcatcctgt cgctgatgca gatgccgcgc       540
     accacggtgg ctgtgcagat gctgcgcgag gccgggttgc cctacatcgt ggtgctgacc       600
     aatccgacca ccggcggcgt caccgcgtct tacgcgatgc tcggcgacat ccaactcgcc       660
     gagccgggcg cactgatcgg ctttgccggc gcccgcgtga tcgaacagac catccgcgag       720
     aagttgccgg acggcttcca gcgcgccgaa tatctcaggg accacggcat ggtcgacatg       780
     gtcgtgcatc gccacgaact gcgccctacg ctggcgcggc tgtgccgaat cctcaccaag       840
     acgccactgc ccgctgtgga agaaatcgcg gcatccgacg atgcggccca ggatgcggaa       900
     gccgcggcgg cgaccgaaat cgtcgtgacg ccgcctgaag cgccgtcgcc gaccgcgccg       960
     caggcgtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page