(data stored in ACNUC7421 zone)

EMBL: CP000283.PE200

CP000283.PE200       Location/Qualifiers
FT   CDS_pept        223692..225038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0200"
FT                   /product="FolC bifunctional protein"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37440"
FT                   /db_xref="GOA:Q13EP9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP9"
FT                   /protein_id="ABE37440.1"
FT                   /translation="MSAATAPQPSALVGELRARLAQLHPAQIDLTLGRIERLLAALDHP
FT                   QRRLPPVIHIAGTNGKGSTLAFLRAILEAAGLSVHAYTSPHLVRVNETVRLGRPGGGAL
FT                   VSDDEFAAALAHCERVNQGAPITLFEIETAAALWLFAQHPADVTLLEVGLGGRLDATNV
FT                   IDQPLACVLTPIGIDHTEFLGPTLADIAAEKAGIIRRGVPVIVAGQQNDAMDVIEREAE
FT                   RLRAPLHARGQQWHVEVEHGRLAYQDDRGLMDLTAPKLFGRHQIDNAWLAIATLRAQQR
FT                   FTFDQAAYQAGLLSADWPARMQRLTTGRLIDEAPPGSELWLDGGHNADGGRVAAAALGD
FT                   LEERVSRPLVIIAGMMANKDASAFLTNFTGLTRHVIAVPIPDRDGAMPPEKLADAGRAL
FT                   GLRVELADSVEAALSRIAGLAYELPPRILITGSLYLAGHVLRLNGTMPS"
     gtgagcgcag cgactgctcc gcagccgtct gctctggtcg gcgagctgcg cgcgcgactt        60
     gcgcagctcc atcccgcaca gatcgatctg acgctcggcc ggatcgaacg gttgctggcg       120
     gcgctcgatc atccgcagcg caggctgccg ccggtgatcc acatcgccgg caccaacggc       180
     aagggctcta ccctcgcctt tctccgcgcc attctcgaag ccgccggcct cagcgtccac       240
     gcctacacct cgccgcatct ggtccgcgtc aacgaaaccg tccgtctcgg acggccgggc       300
     ggcggcgcgc tggtgagcga cgatgaattc gccgcggcgc tggcgcattg cgagcgcgtc       360
     aatcaaggcg cgccgatcac gctgttcgag atcgaaaccg ccgcggcgct gtggctgttc       420
     gcgcaacatc ccgccgacgt cacgctgctg gaagtcggcc tcggtggccg gctcgacgcc       480
     accaacgtga tcgaccagcc gctcgcctgt gtgctgaccc cgatcggcat cgaccacacc       540
     gagtttctcg ggccgacgct cgcggacatc gccgccgaaa aggctggcat catccgccgc       600
     ggtgttccgg tgatcgtggc cgggcagcag aacgatgcga tggacgtgat cgagcgcgaa       660
     gccgagcggc tacgcgcgcc gctgcacgcg cgcggccagc aatggcatgt cgaggtcgaa       720
     cacggccggc tcgcctatca ggacgaccgc ggcctcatgg acctcaccgc gccaaaactg       780
     ttcggccggc accagatcga caatgcctgg ctggcgatcg cgacgctgcg cgcgcaacaa       840
     cgcttcacct ttgaccaggc cgcctatcag gcagggttgt tgtcggcgga ctggccggcg       900
     cggatgcagc ggctgacgac cggcaggctg atcgacgaag cgccacccgg cagcgaactc       960
     tggctcgacg gcggccacaa tgccgacggc ggccgcgtcg ccgcagcggc gctcggcgat      1020
     ctggaagagc gggtgtcgcg gccgctggtg atcattgccg gcatgatggc caacaaggac      1080
     gccagcgcgt tcctgaccaa tttcaccgga ctgacccgcc acgtcatcgc ggtgccgatc      1140
     cccgatcgcg acggcgcgat gccgccggaa aagctcgccg acgccgggcg cgcgctcggc      1200
     ctgcgggtcg aactcgccga tagcgtggag gcggcgctga gccggatcgc cggccttgcc      1260
     tatgagctgc caccgcgcat cctgatcacc ggctcgttgt atctcgccgg ccatgtactg      1320
     cgcctcaacg gcacaatgcc gagctga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page