(data stored in ACNUC7421 zone)

EMBL: CP000283.PE202

CP000283.PE202       Location/Qualifiers
FT   CDS_pept        complement(225807..229286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0202"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit A"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37442"
FT                   /db_xref="GOA:Q13EP7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP7"
FT                   /protein_id="ABE37442.1"
FT                   /translation="MSAPRSIPDQARERQILASDPSASVFVSANAGSGKTHVLVQRVIR
FT                   LLLDGVPPERILCITFTKAAAANMAERVFTTLGRWVTLDDEALTAAIKATGIKSVGPSL
FT                   LAQARKLFACALETPGGLKVQTIHALCTRLLQQFPFEANVPARFSVLDDRDQAELMQRA
FT                   SLAVLLQAAAAPDSAAGRALTLAMTSAADVTFREVVQEACTRRDRFLAWITQAGGVDGA
FT                   MAQLSATLGVAPQDRCEDVERDILDGPNLPRAQWSTAAAMFESGSANDQAQAKRLRAAL
FT                   ALSDVAQLDKYCEVFFTKDGPRKSLATKKIADAAPGFVEDLKREGARLEDLLERRRALL
FT                   MRERTRALLVIAADVAERIRREKQERGLLDYDDLIDKTLAMLDSGASSWVHFKLDRGVD
FT                   HVLIDEAQDTSPKQWDIVAHLIAEFTAGEGARDGVRRTVFAVGDEKQSIFSFQGAVPKE
FT                   FAERRDLLQRRFHGAGLNFEKVSFNYSFRSGATILQSVDHVFRDPDIYRSIHADAAYPL
FT                   HQSLADAGPSVIDLWPLELPDDKQNIEGWRAPFDAVSETSPEVRLAQKVQAEIASLIAG
FT                   GTMTGSLGDRRRLRFGDVLVLVRRRGSAFDAVIQALKRGGIPVAGADRLKLTEHIAIID
FT                   LMNLADALLLPQDDLALAVALKSPLFGLDDDDLFRLAWRRKGSLRHALREKAAGDAKLA
FT                   TALQRLDACAERSQTDTPFGFYAWLLGGVGGRARILRRLGPEANDALDEFLELALSYEQ
FT                   KAAPSLQGFMAWLRAADTEIKRDMEISRDEVRVMTVHGAKGLEAPVVFLVDTTSSPSDT
FT                   QRLNLIRLPGGNAQPGSVGAMVWAGRKSNDPRVVEQARAEMVSETEDEYRRLLYVAMTR
FT                   AADRLIVGGCMPGNRNEVRALSWYDLISKGLENSGLTMRTAPPDGAVKRYCRPEDEVTE
FT                   IAPSEQAPAAPPLVMPDWLHKAAPALRRPDNLLRPSDPDDADHRRIRRGETEAQRQRAL
FT                   QRGTLVHRLLQSLPDLPADIRANAADRFLLRNADDWSPQERDALAARVLEVISDDRFAA
FT                   VFAPGSRAEVPIVGRLQRHGEPVLISGQIDRLVVTDAEVLIVDYKTNHAPPRSLAETPP
FT                   AYVRQLALYRAVLSLLYPQRIVRAALLWTEAPEIMEISAPALDAEQAALTVA"
     gtgagcgcgc cgcgcagcat tcccgatcag gcgcgcgagc gtcagatcct cgcctccgat        60
     ccctcggcct cggtgttcgt ctcggccaat gccggctccg gcaagacgca tgtgctggtt       120
     cagcgggtca ttcgcctgct gctcgatggc gtgccgccgg aacgcatcct gtgtatcacc       180
     ttcaccaaag ccgccgccgc caacatggcc gagcgcgtct tcacgacact cggtcgctgg       240
     gtgacgctcg acgacgaggc gctgacggct gcgatcaagg cgactggtat caagtcggtt       300
     gggccttctc ttctggcgca agcgcgaaaa ctgtttgcct gcgcgctgga gacgccgggc       360
     gggctgaagg tgcagaccat ccacgcgctc tgcacccggt tgctgcagca gtttccgttc       420
     gaggccaatg tgccggcgcg gttcagcgtg ctcgacgatc gcgatcaggc cgagctgatg       480
     cagcgcgcca gcctcgcggt gttgctgcag gcggcggccg cgccggacag cgcggcgggg       540
     cgggctctga cgttggcgat gaccagcgcc gccgacgtca ccttccgcga ggtggtgcag       600
     gaagcctgca ccaggcgcga tcgcttcctc gcctggatca cgcaggccgg cggcgtcgac       660
     ggcgccatgg cgcagctctc ggcgacgctc ggcgtcgcgc cgcaggatcg ctgcgaagac       720
     gtcgagcgcg acatcctcga cggcccgaat ctgccgcgcg cgcaatggtc tacggcagca       780
     gcgatgttcg agtcggggag cgccaacgac caggcgcagg cgaagcgtct gcgcgcggcg       840
     ctcgcgctgt cggacgtggc gcagctcgac aagtattgcg aggtgttctt caccaaggac       900
     ggcccgcgca aaagtctggc caccaagaag atcgccgacg ccgcgcccgg gttcgtcgag       960
     gatctgaagc gcgaaggcgc gcggctcgaa gatctgctcg agcgtcgccg cgcgctcctg      1020
     atgcgcgagc ggacgcgggc gctgctggtg atcgcggccg acgtcgccga gcggatccgg      1080
     cgcgagaagc aggagcgtgg gcttctcgat tatgacgatc tgatcgacaa gacgctcgcg      1140
     atgctcgata gcggcgcgtc gagctgggtg catttcaagc tcgatcgtgg cgtcgaccac      1200
     gtgctgatcg acgaggcgca ggacaccagc ccgaagcaat gggacatcgt cgcgcatctg      1260
     atcgcggaat tcaccgccgg cgagggcgcg cgcgatggcg tgcggcgcac ggtgttcgcg      1320
     gtcggcgacg agaagcagtc gatcttctcg ttccagggcg cggttccgaa ggaattcgcc      1380
     gagcggcgcg atctgttgca gcggcgcttc cacggcgccg gactgaactt cgagaaggtg      1440
     agtttcaact actcgttccg ctccggcgcg acgatccttc agtccgtgga ccacgtgttc      1500
     cgcgatcccg acatctatcg cagtatccac gccgacgccg cctacccgct gcatcaatcg      1560
     ctggccgatg ccggcccgag cgtgatcgat ctgtggccgc tcgaactgcc cgacgacaag      1620
     cagaacatcg agggctggcg tgcgccgttc gatgcggtgt cggaaaccag tccggaggtg      1680
     cggctggcgc agaaggtgca agccgagatc gcgtcgctga ttgcgggcgg cacgatgacg      1740
     ggctcgctcg gcgaccggcg gcggctgcgt tttggcgatg tgctcgtgct ggtgcgccgt      1800
     cgcggctcgg cgttcgacgc ggtgatccag gccctgaagc gcggcggcat tccggtggcc      1860
     ggcgccgacc ggctgaagct caccgagcat atcgcgatca tcgatctgat gaatctcgcc      1920
     gacgcgttgc tgctgccgca ggacgatctt gcgctcgcgg tggcgctgaa gagcccgctg      1980
     ttcggcctcg acgacgacga tctgttcagg ctggcgtggc gacgcaaagg ctcgctgcgc      2040
     catgcgctgc gcgagaaggc ggccggggac gcaaagttgg caaccgcgtt gcagcggctc      2100
     gatgcctgcg cggagcggtc gcagaccgac acgccattcg ggttctacgc ctggctgctc      2160
     ggcggcgtcg gcggccgcgc aaggattttg cgcaggctgg ggccggaagc caacgacgcg      2220
     ctcgacgagt ttctcgaatt ggcgctgagc tacgagcaga aggctgcgcc gtcgctgcag      2280
     ggcttcatgg cgtggctgcg cgccgccgat accgagatca agcgcgacat ggaaatctcg      2340
     cgcgacgaag tccgggtgat gaccgtgcat ggcgccaagg gtctcgaggc gccggtggtg      2400
     ttcctggtcg atacgacgtc gtcgccgtcc gacacccagc ggctcaatct gatccggctg      2460
     cccggcggca atgcgcagcc gggctccgtc ggcgcgatgg tgtgggcggg ccgcaagtcg      2520
     aacgatccgc gcgtcgtcga gcaggcccgc gcggagatgg tcagcgagac cgaggacgaa      2580
     tatcgccggc tgctctatgt ggcgatgacc cgcgccgccg atcggctgat cgtcggcggc      2640
     tgtatgcccg gcaatcgcaa cgaggtgcgc gcgctgtcct ggtacgatct gatcagcaag      2700
     ggcttggaga actccggcct gacgatgcgc acggcgccgc cggatggcgc ggtgaagcgc      2760
     tattgccgtc ccgaggacga ggtcacagag atcgcaccgt ccgaacaagc gcctgccgcg      2820
     ccgcccctcg tcatgccgga ctggctgcac aaggccgcgc cggcgctgcg ccggccggac      2880
     aatctgttgc ggccatccga cccggacgat gccgatcatc gccgcatccg ccgcggcgaa      2940
     acggaggcgc aacgccagcg cgccttgcag cgcggcacgc tggtgcaccg gctgctgcag      3000
     tcgctgcccg atctgccggc cgacattcgc gccaatgccg ccgaccgctt cctcctccgc      3060
     aacgccgatg attggagccc gcaggagcgc gacgcgctcg ccgcgcgggt gctggaggtg      3120
     atcagcgacg accgcttcgc cgccgtcttc gctcctggca gccgcgccga agtgccgatc      3180
     gtcggtcgct tgcagcggca tggcgagccg gtgctgatct ccggccagat cgaccggctg      3240
     gtggtgaccg acgccgaggt cctgatcgtc gactacaaga ccaatcacgc cccgccgcgc      3300
     agtctggcgg agaccccgcc ggcttacgtc cgccagctcg cactgtatcg ggcggtgcta      3360
     tcgctgctgt atccacagcg gatcgtccgc gccgccctgc tatggaccga agcgcctgaa      3420
     atcatggaga tttcagcccc tgcgctggac gcggagcagg ccgccttgac ggtggcgtga      3480
//

If you have problems or comments...

PBIL Back to PBIL home page