(data stored in ACNUC7421 zone)

EMBL: CP000283.PE207

CP000283.PE207       Location/Qualifiers
FT   CDS_pept        complement(235444..237957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0207"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37447"
FT                   /db_xref="GOA:Q13EP2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP2"
FT                   /protein_id="ABE37447.1"
FT                   /translation="MSDVLGSMRRTCLSCTSLVRGLAGAGLLAASSPAWAADDPLATLT
FT                   SRFMFDFNRHELVTLAMAASVLGFSVVSAILLMRTRQRAAAQEAQLRADVQTLQAESDR
FT                   FRALLFAEPQVLISWSAGDDRPQISGDTALLLPQEVANAQPQRVLAFGTWLPPEPALQM
FT                   DHAVDALLDKGEAFLLHLTTSTGRSIEAMGRAIGGQAILRIRELSGIRRELADMSRRFK
FT                   SLQDESEMLRGFANAAPWPIWTRRASGELSFANAAYARATDAGSAADAVNRNLELLDSN
FT                   DRGNLARALNDNAQFAARLPIVVSGERRYFDVRALRLSGGSAGIAVDASEAAALGAALV
FT                   RMAEAHRRTLDQLSSGVAVFDAQRRLAFYNDSYRRLWDLDRAFLDSNPDDSSVIDRLRA
FT                   ARKLPEERDFREWKKKLHEAYRAVEPEKAIWYLPDGRAISIVTTPNQEGGVTYLFDDVT
FT                   ESLELQRRYGGLIDVQRETLDNLTEAVAVFGSNGCAQLFNPAFTRMWNLSPEALNNRPH
FT                   IETVEEWCRPLFDDAVSWQALRSAITGIDDRKHVLLKLERKDGTVLSCKTMPLPDGATM
FT                   LTFLDISDTENVERALRERNEALETADRIKVDFVHHVSYELRSPLTTIIGFAHLLGDPS
FT                   TGPLNDKQSEYIAYITSSTNALMAIINNILDLASIDAGAMTLNLGPIDIGRAIDAAAEG
FT                   IQDRLARDQITLDVEIDPAVGEFVGDERRVVQVLYNLLANAVGFSPNQATVTLVVHKIG
FT                   AKVVFTVTDAGPGIAPELKDKVFDWFESHSQGSRHRGPGLGLALVRSFVELHGGKVQVD
FT                   SVVGRGTSVICEFPIEPSAQRNAAE"
     atgtcagacg tattggggtc gatgcgtcgg acctgcttgt cgtgcacgtc gctggtgcgc        60
     ggccttgcgg gcgctggcct tctcgcggcg tcgtcgcccg cctgggcggc tgacgatccg       120
     ctcgccactc tgacgtcccg cttcatgttc gatttcaacc gccacgagct tgtcacgctc       180
     gcgatggcgg cgtcggtgct cggcttctcc gtcgtgtccg cgatcctgct gatgcgcacg       240
     cggcaacgcg ccgccgcgca ggaagcgcag ctgcgcgccg acgttcagac tcttcaggcc       300
     gagtccgatc gcttccgcgc attgctgttc gccgagccgc aggtgctgat ctcctggtcc       360
     gccggcgacg accggccgca gatcagcggc gacactgcgc tgttgctgcc gcaggaggtg       420
     gcgaacgccc agccgcagcg cgtcctcgct ttcggcacat ggctgccgcc ggaacccgcg       480
     ctgcagatgg atcatgcggt cgacgcgctg ctcgacaagg gcgaagcctt tctgctgcat       540
     ttaacgacgt cgaccggccg ttcgatcgag gcgatgggcc gcgccatcgg tggtcaggcg       600
     atcctgcgaa tccgcgaact gagcggcatt cgtcgcgaac tcgccgacat gtcgcggcgc       660
     ttcaagtcac tgcaggacga gtccgagatg ctgcggggct tcgccaatgc cgcgccctgg       720
     ccgatctgga cccggcgcgc ctcgggcgaa ctgagcttcg ccaacgccgc ctatgcgcgc       780
     gcgaccgatg cgggcagcgc ggcggacgcg gtcaatcgca atctcgaact gctcgacagt       840
     aacgaccgcg gcaatctcgc gcgcgcgctc aacgacaatg cccaattcgc cgcgcgtctt       900
     ccgatcgtgg tcagcggcga gcgccgctat ttcgacgttc gcgcgttgcg gctgagcggc       960
     ggcagcgccg gcatcgcggt ggatgcgagc gaagccgcgg cgctcggcgc cgcgttggtg      1020
     cggatggcgg aggcgcatcg ccgcacgctc gaccagttgt cgtcaggcgt cgcggtgttc      1080
     gacgcgcagc gccggctcgc cttctacaac gattcctatc gcaggctgtg ggatctggac      1140
     cgcgccttcc tcgacagcaa ccccgacgat tccagcgtga tcgaccgttt gcgcgccgcg      1200
     cgcaaactgc ccgaagagcg cgatttcagg gagtggaaga aaaagctgca cgaggcctat      1260
     cgggcggtcg agccggagaa ggcgatctgg tatctgcccg acggccgcgc gatcagcatc      1320
     gtcaccacgc ccaatcagga gggcggcgtc acctatctgt tcgacgacgt caccgagagc      1380
     ctggaactgc agcgccgcta cggcggcctg atcgatgtcc agcgcgagac gctcgacaat      1440
     ctgaccgagg cggtcgcggt gttcggcagc aatggctgcg cgcaattgtt caaccccgcg      1500
     ttcacgcgga tgtggaatct ctcgccggaa gcgctcaaca accggccgca tatcgaaacc      1560
     gtcgaggaat ggtgccgccc gctgttcgac gacgcggtga gttggcaggc gctgcgtagc      1620
     gcgatcaccg gaatcgacga ccgcaagcac gtgctgctga agctcgagcg caaggacggc      1680
     accgtgctgt cctgcaagac gatgccgctg cccgacggcg cgacgatgct gacgttcctg      1740
     gacatcagcg acaccgagaa tgtcgagcgc gccttgcggg agcgcaatga ggcgctggag      1800
     acggccgacc gcatcaaggt cgatttcgtc caccacgtgt cttacgaatt gcgttcgccg      1860
     ctgacgacga tcatcggctt cgcgcatctg ctcggcgatc cgagcaccgg tccgctcaac      1920
     gacaagcagt ccgaatacat cgcctacatc acctcgtcga ccaacgcgct gatggcgatc      1980
     atcaacaaca tcctcgatct cgccagcatc gacgccggcg cgatgacgct caatctcggg      2040
     ccgatcgata tcggtcgcgc gatcgacgcg gccgccgaag gcattcagga tcgcctcgcg      2100
     cgcgatcaga tcacgctcga cgtcgagatc gatcccgcgg tcggcgaatt tgtcggcgac      2160
     gaacgccgcg tcgtgcaggt gctgtacaat ctgctcgcca atgcggtcgg cttctcgccg      2220
     aaccaggcga ccgtgacgct cgtggtccac aagatcggcg cgaaggtggt cttcaccgtg      2280
     accgacgccg gtcccgggat tgcgccggag ctgaaggaca aggtgttcga ctggttcgag      2340
     agccactccc agggctcgcg gcatcgcggc ccgggcctcg gcctggcgct ggtgcgctcc      2400
     ttcgtcgaac tgcacggcgg caaggtccag gtcgattcgg tggtcggacg cggcacttcg      2460
     gtgatctgcg aatttccgat cgaaccgtcc gcgcagcgca acgccgccga atga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page