(data stored in ACNUC7421 zone)

EMBL: CP000283.PE220

CP000283.PE220       Location/Qualifiers
FT   CDS_pept        251784..252347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0220"
FT                   /product="3-hydroxydecanoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37460"
FT                   /db_xref="GOA:Q13EM9"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EM9"
FT                   /protein_id="ABE37460.1"
FT                   /translation="MAEFRELKRQSRMRDRRSSYEYEDLLACGRGELFGPGNAQLPLPP
FT                   MLMFDRITEISETGGAHGKGLIRAELDVNPDLWFFACHFKGDPVMPGCLGLDALWQMLG
FT                   FFLGWSGGEGPGRALGSGELKFTGQVLPHVRKVVYNVDIKRVMRSKLWLGIADGWLSAD
FT                   DEIIYRAQDLKVGLFKQTAAKPAA"
     atggccgaat tccgggaatt gaaaaggcaa agccgaatgc gggaccgtcg ttccagctac        60
     gaatatgaag atctgctggc ctgcggccgt ggcgaattgt tcggccccgg caatgcgcag       120
     ctaccgttgc cgccgatgct gatgttcgat cgcatcacag agatcagcga gaccggcggc       180
     gcgcacggca aggggctgat ccgggccgag ctcgacgtta acccggacct ctggttcttc       240
     gcctgccact tcaagggcga cccggtgatg ccgggctgcc tcggcctcga cgcgctgtgg       300
     cagatgctcg gcttctttct cggctggtcc ggcggcgaag gtcccggccg cgcgctcggt       360
     agcggcgaac taaagttcac tggccaggtg ctgccgcacg tccgcaaagt cgtctacaat       420
     gtcgacatca agcgggtgat gcgttcgaag ctgtggctcg gcatcgccga cgggtggttg       480
     tcggccgacg acgagattat ctaccgggct caggacctca aggtcggcct gttcaagcag       540
     accgcggcga agccggcggc ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page