(data stored in ACNUC7421 zone)

EMBL: CP000283.PE221

CP000283.PE221       Location/Qualifiers
FT   CDS_pept        252427..253653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0221"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37461"
FT                   /db_xref="GOA:Q13EM8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM8"
FT                   /protein_id="ABE37461.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFR
FT                   SQVQGLPSLNPADVVDRRAMRFLGEGAAWNHVAMEQALADSGLEESDISNPRTGIVMGS
FT                   GGPSARTIVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYELIQWGKQDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDV
FT                   SRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKM
FT                   ALSTTGGIKIDYINPHATSTPAGDPPEINALRNVFGAGDKCPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESANITELDPAFADMPIVRKRIDNAKIGAVLSNSFGFGGTNA
FT                   TLVFKRLDA"
     atgagacggg ttgttgtcac ggggatgggt atcgtctcat cgatcggaaa caacacacag        60
     gaggtgctgg cgagtctgca cgacgccaag tcgggcatct cgcgggccga aaaacatgcc       120
     gagctgggct tccgctctca ggttcagggc ttgccgtcgc tgaatccggc cgacgtggtc       180
     gaccgccgcg cgatgcgctt cctgggcgaa ggcgcggcct ggaaccacgt cgcgatggaa       240
     caggcgctgg ccgattccgg gctcgaggaa agcgacatct ccaacccgcg caccggcatc       300
     gtgatgggct cgggcggccc gtccgcccgc accatcgtcg aggcggccga catcacccgc       360
     accaagggtc cgaagcgcgt cggcccgttc gcggtgccga aggcgatgtc gtcgacggcg       420
     tcggcgacgc tcgccacctg gttcaagatc aagggcgtca actactcgat ctcgtcggcc       480
     tgcgcgacct cgaaccactg catcggcaac gcctatgagc tgatccagtg gggcaagcag       540
     gacgtcgtgt tcgccggcgg ctgcgaggaa ctcgactggt cgctgtcggt gctgttcgac       600
     gcgatgggcg cgatgtcctc gaaatacaac gacaccccgg ccaccgcctc gcgtccctat       660
     gacgtcagcc gcgacggctt cgtgatcgcc ggcggcgccg gcgtgctggt gctggaagaa       720
     ctcgaacacg ccaaggcgcg cggcgccaag atttatggcg agatcatcgg ctacggcgcc       780
     acctcggacg gctacgacat ggtcgcgccg tccggcgaag gcgccgagcg ctgcatgaag       840
     atggcgcttt cgaccaccgg cggcatcaag atcgactaca tcaatccgca cgcgacctcg       900
     acgccggccg gcgacccgcc ggagatcaac gcgctccgca acgtgttcgg cgccggcgac       960
     aagtgcccgc cgatctccgc caccaaggcg ctgaccggcc actcgctcgg cgccaccggc      1020
     gtgcaggaag cgatctattc gctgctgatg atgcagaacg gcttcatctg cgagagcgcc      1080
     aacatcaccg aactcgaccc ggcgttcgcc gacatgccga tcgtgcgcaa gcggatcgac      1140
     aacgccaaga tcggcgccgt gctgtcgaat tcgttcggct tcggcggcac caacgcgacg      1200
     ctggtgttca agcggctgga cgcgtaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page