(data stored in ACNUC7421 zone)

EMBL: CP000283.PE235

CP000283.PE235       Location/Qualifiers
FT   CDS_pept        273587..274672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37475"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EL4"
FT                   /protein_id="ABE37475.1"
FT                   /translation="MSAALLLAPELDDVVGHGDAARRADAVRRIADLFVQGAMNFNAEH
FT                   VAVFDGVLVRLIPDTDGDLRGELARRFCSLGNAPPTLIEQLAQDEDIGVAGPLLRRSTQ
FT                   ITDDTLVELAEVRGQTHLMAISERPAISPPVTDVIVRRGDRDVLRMVAVNAGAAFSAFG
FT                   FSGLIRRAAQDGVLAVAVGVRDDLSLPRLKDLLASSSEPVRRKLFETASPSARIAINRA
FT                   LRELTGEPMQPSVKRDFAPAQRAIVALHNAGGLTEQALLSFARAFQYEETVAALSAMSG
FT                   VRITTLDPLMAGERHDPMLMLGKALGLDWTTVRAMIGLRRGPDRMPSSPDVEEARQNFE
FT                   RLAPSTAHQVVGFWKMRQAMN"
     atgtccgccg cccttctgct cgcacccgaa ctggacgacg tcgtcggcca tggcgatgcc        60
     gcgcggcgcg ccgatgccgt gcggcggatc gccgacctgt tcgtgcaagg cgcgatgaat       120
     ttcaacgccg aacatgtcgc ggtgttcgac ggcgtcctgg tgcgactgat acccgacacc       180
     gacggcgatc tgcgcggcga gctggcgcgg cggttctgct cgctcggcaa cgcgccgccg       240
     acgctgattg agcaattggc gcaggatgag gacatcggcg ttgccgggcc gctgttgcga       300
     cgctcgacgc agatcaccga cgacacgctg gtggagctcg ccgaagtgcg cggccagacc       360
     catctgatgg cgatctccga gcggccggcg atctcgccgc cggtcaccga cgtgatcgtc       420
     cgccgtggcg atcgcgacgt gttgcggatg gtcgcggtga atgccggcgc ggcgttttca       480
     gcctttggct tcagcggcct gatccgccgc gcggcacagg acggcgtgct ggccgtcgcc       540
     gtcggcgtgc gtgacgacct gtcgttgccg cggttgaaag atctgctggc gtcctcgagc       600
     gaaccggtgc gccggaagct gttcgaaacg gcgtcgccga gcgcccgaat cgcgatcaac       660
     cgcgcgctgc gcgaactcac cggcgagccg atgcagccct cggtgaagcg cgactttgcg       720
     ccggcgcaac gcgcgatcgt ggcgctgcat aatgccggcg gcctcaccga gcaggcgctg       780
     ctcagcttcg cccgggcatt ccaatacgag gaaacggtgg cggcgctgtc ggcgatgtcc       840
     ggcgtgcgga tcacgacgct cgacccgttg atggcgggcg aacgccacga cccgatgctg       900
     atgctcggca aggcgctcgg cctcgactgg accacggtgc gcgcgatgat cgggctgcgg       960
     cgcgggccgg accggatgcc gtcctcgccc gacgtcgagg aggcgcggca gaatttcgag      1020
     cggctggcgc cctcgaccgc acatcaggtg gtcggcttct ggaaaatgcg acaggcgatg      1080
     aactga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page