(data stored in ACNUC7421 zone)

EMBL: CP000283.PE24

CP000283.PE24        Location/Qualifiers
FT   CDS_pept        29308..29997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37264"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F75"
FT                   /protein_id="ABE37264.1"
FT                   /translation="MVVRNKAAKITRSDATRRVVTYRSGHFTGYVASRKSSTVVQYESI
FT                   LERDFIYLLETDRDVLWFSEQPAPLKFSDGIAHHTWTLDFEIERSSGRYLVEVKPLSKV
FT                   KKYRLDVIYGFARAAAKASGYQNLELWTDRELKALPRLPNAEILVGSDTTYHDPAYDLA
FT                   LLSTIAEIAKVSERTTVRELRSLSRLGPLSYRAVMRQIAIGGLIPADSTVFLGDDAILL
FT                   IPGGGGF"
     atggtagtta ggaacaaggc agccaaaatc acgcgctcgg acgcgacccg cagggtcgtc        60
     acttatcgaa gcggacattt caccggctac gtcgcctcac ggaagagcag caccgtcgtc       120
     cagtatgaaa gcatcctgga gcgggacttc atctatttgt tggagaccga ccgcgacgtg       180
     ttgtggtttt ccgagcagcc ggcgccgcta aaattttcgg acggcatcgc gcaccataca       240
     tggacgcttg atttcgagat tgagcggtcg tctggccggt acctcgttga ggtcaagcca       300
     ctttccaagg tgaagaagta tcggcttgac gtaatttacg gctttgcgag ggcggcggct       360
     aaggcctcgg gataccagaa cctggagttg tggaccgacc gcgaactgaa ggctcttcct       420
     cgtttgccta acgccgagat tcttgtcggc agcgacacga cgtatcatga cccggcatat       480
     gatctggcgc tcttatccac catcgccgag atcgcgaagg tttctgagcg aacaacggtg       540
     cgcgagttgc gctcgctgtc gcgactagga ccgctgtcgt atcgggctgt gatgcgacag       600
     atcgcgatcg gaggcctgat cccggcggac tctacggtgt ttctaggcga cgacgccatc       660
     cttctcatcc cgggtggagg aggtttctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page