(data stored in ACNUC7421 zone)

EMBL: CP000283.PE240

CP000283.PE240       Location/Qualifiers
FT   CDS_pept        complement(279055..279642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0240"
FT                   /product="protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37480"
FT                   /db_xref="GOA:Q13EK9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EK9"
FT                   /protein_id="ABE37480.1"
FT                   /translation="MPQSNAGGRSDCIGAARDSSFGPMSSSAIPATEVVIAADCWQAEA
FT                   SAESVVLRAIEAAATMIDADTGDAELAVMLTDDDGVRALNASYRGIDKPTNVLSFPAPQ
FT                   PDYQDACQDSGGAPQMLGDIAIAYQTVRREADDEGKPFAHHLSHLAVHGFLHLVGYDHE
FT                   TDAEAETMESTERSILAGLGIPDPYADQDRVS"
     atgccacaat ccaacgccgg gggccgttcc gattgcatcg gggcggctcg ggacagtagt        60
     ttcggaccga tgagtagttc agccattccc gccaccgagg tcgtgattgc cgccgattgc       120
     tggcaagccg aggcctccgc cgaatccgtc gtgctgcgcg cgatcgaagc cgcggcgacg       180
     atgatcgacg ccgacaccgg cgacgccgag cttgcggtca tgctcaccga cgacgacggc       240
     gtccgcgcgc tcaacgcgtc ctatcgcggc atcgacaagc cgaccaacgt cctgtcgttt       300
     ccggcgccgc agcccgacta tcaggatgcc tgtcaggact ccggcggtgc gccgcagatg       360
     ctcggcgaca tcgcgatcgc ttaccagacg gtgcgccgcg aagccgacga cgagggcaag       420
     ccgttcgctc atcatctcag ccatctcgcg gtccatggct ttctgcatct ggtcggctac       480
     gatcacgaga ccgacgccga ggccgaaacg atggaatcca ccgagcgcag cattctcgcg       540
     ggtctgggta ttccggatcc ctatgctgat caggatcggg tgagctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page