(data stored in ACNUC7421 zone)

EMBL: CP000283.PE242

CP000283.PE242       Location/Qualifiers
FT   CDS_pept        complement(280703..282124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0242"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37482"
FT                   /db_xref="GOA:Q13EK7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EK7"
FT                   /protein_id="ABE37482.1"
FT                   /translation="MAPPRKLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADLV
FT                   ILNTCHIREKASEKVYSELGRLRLARDEAASSGRRMQIAVAGCVAQAEGEEIVRRAPVV
FT                   DVVVGPQSYHHLPQLLARADQAGRALETEFPVEDKFGFLPQPRPETIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEVSRPVSAIIDDVKRLADNGVREITLIGQNVNAYHGEGPDS
FT                   RAWTLGRLLRRLAAVPGIVRLRYSTSHPNDVDDELIEAHRDLDALMPFVHLPVQSGSDP
FT                   ILAAMNRKHTAADYRRVIDRFRAVRPQIAFSSDFIVGFPGETEADFAATLALVTQIGYA
FT                   GAYSFKYSPRPGTPAADMQEMVPAAVMDERLERLQQLIDSQQSAFNKAAIGQTVDVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVFPGPMFLGPGMAPDSLVGQILPVRVDSLERYSLLGELA
FT                   AKPPQHARPLAATGA"
     atggccccgc cgcgcaagct gcacatcaag tcctatggtt gtcagatgaa tgtctacgat        60
     gcccagcgca tggtggacgt gctggcgccc gagggctttg tcgagaccgc gacggtggac       120
     gacgccgatc tggtgatcct caacacctgc cacattcgcg agaaggcctc cgagaaggtg       180
     tattcggagc tcggccggct gcgtctggcg cgcgacgagg cggcaagttc cggccgccgg       240
     atgcagatcg cggtcgccgg ctgcgttgcg caggcggagg gcgaggagat cgtccgccgc       300
     gcccccgtgg tcgacgtcgt ggtcgggccg cagagctatc accatctgcc gcagcttctg       360
     gcgcgcgccg atcaggccgg ccgcgcgctc gaaaccgaat ttccggtcga ggacaaattc       420
     ggcttcctgc cgcagccgcg gccggaaacc atccgcgccc gcggcatttc ggctttcgtc       480
     accgtgcagg agggttgcga caagttctgc accttctgcg tggtgcccta tacccgcggc       540
     gccgaagtct cgcgcccggt gtcggcgatc atcgacgacg tcaagcgcct cgccgacaac       600
     ggcgtccgcg agatcacgct gatcggccag aacgtcaacg cctatcatgg cgaggggccg       660
     gacagccgcg cctggacgct cggccgcctg ctgcgccggc tcgccgcggt gccgggcatt       720
     gtccggctgc gctattccac cagccatccc aacgacgtcg atgacgaact gatcgaagcg       780
     catcgcgacc tcgacgcgct gatgccgttc gtgcatttgc cggtgcagtc cggatcggac       840
     ccgattctgg ccgccatgaa ccgcaagcac accgccgccg attatcgccg ggtgatcgac       900
     cggttccgcg cggtgcggcc gcagatcgcc ttctcatcgg attttatcgt tgggttcccg       960
     ggcgagaccg aggcggattt cgccgccacc ctcgcactgg tcacacaaat cggttacgct      1020
     ggcgcatatt cgttcaaata ttcgccgcgg cccggcacgc ccgcggcgga catgcaggag      1080
     atggtgcccg cagcggtgat ggatgagcgt ttggagcggc tccagcaatt gatcgacagt      1140
     cagcaatcgg ccttcaacaa ggcggcgatc ggccagaccg tggatgtgct gttcgagcgc      1200
     gccggccgca agccgggcca gatcgtcggc cgcaccgctt atctgcagcc cgcccacgtt      1260
     tttccaggcc cgatgtttct aggtcccggg atggcgcccg acagcctcgt cgggcagatc      1320
     ctcccggtcc gggtcgacag tctcgagcgt tacagcctgc tcggcgaact ggcggccaag      1380
     ccgccgcagc atgctcgtcc tttggccgcc actggagcct ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page