(data stored in ACNUC7421 zone)

EMBL: CP000283.PE245

CP000283.PE245       Location/Qualifiers
FT   CDS_pept        complement(283463..283948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0245"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37485"
FT                   /db_xref="GOA:Q13EK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK4"
FT                   /protein_id="ABE37485.1"
FT                   /translation="MMTWLAEFWGYADALVEPATLSDSPKLAQLHAASFHSGWSEEEFA
FT                   DLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSVAVASGYRGRGLSRELLLTHLGH
FT                   LAGRGVAKVFLEVEENNQPARRLYQRSGFEIVGRRERYYRQPDGEQLNALIMRRDLS"
     atgatgacat ggttggccga attctggggt tacgccgacg ccctggtcga acccgcgacg        60
     ctgagcgaca gcccgaagct ggcgcagctc cacgccgcgt cgttccacag cggctggagc       120
     gaagaggagt tcgccgacct tttgagccag cgcaacacgc tggtgcaccg attgcgtatg       180
     ggacgtagga tcatcggttt catcgcctcc cgattcgggg cggatgaagc cgagatactc       240
     tccgtcgcgg tggcctccgg ttaccggggt cggggtttgt cgcgagagct gttactgacg       300
     catctcggtc atctcgccgg ccgcggtgtc gccaaagtgt ttctcgaggt cgaggaaaac       360
     aaccagccgg cgcggcgtct ctatcagcgc tccggtttcg aaattgtcgg gcgccgcgag       420
     cgctactacc ggcagcccga cggcgagcaa ttgaacgcat tgataatgcg tcgcgacttg       480
     tcctag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page