(data stored in ACNUC7421 zone)

EMBL: CP000283.PE248

CP000283.PE248       Location/Qualifiers
FT   CDS_pept        complement(285516..286010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37488"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK1"
FT                   /protein_id="ABE37488.1"
FT                   /translation="MSTQRQSYRPDHRPKCLVIVDDTAEWDRAVYYASRWAVRVGGGVV
FT                   MLRVIEILDQNQQWLGVADVMRAEAIEIAEQALDRASGRANGVAGITPERVIREGDTIA
FT                   QVRKVIESDVDITTLVLAAGDGPEGPGPIVTAMVRHLGSFPVPVVMVASGLTDDDIDAL
FT                   S"
     atgtcaacgc agcgacaaag ctaccggccg gatcaccggc cgaaatgtct ggtgatcgtc        60
     gacgacaccg ccgaatggga tcgcgcggtg tactatgcca gccgctgggc ggtgcgggtc       120
     ggcggcggcg tggtgatgct gcgggtgatc gagatcctcg accagaacca gcaatggctc       180
     ggggttgccg atgtgatgcg cgccgaggcg atcgagatcg ccgaacaggc gctcgaccgc       240
     gcctccggcc gcgccaacgg cgtcgccggg atcacccccg aacgggtgat ccgcgagggc       300
     gacaccatcg cgcaggtccg caaggtgatc gagagcgacg tcgacatcac cacgctcgtg       360
     ctcgcggccg gcgacggccc ggaaggcccg ggcccgatcg tcaccgcgat ggtccgccat       420
     ctcggctcgt tcccggttcc ggtggtgatg gtggcgtccg gcctgaccga cgacgacatc       480
     gacgcgctga gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page