(data stored in ACNUC7421 zone)

EMBL: CP000283.PE254

CP000283.PE254       Location/Qualifiers
FT   CDS_pept        293543..293869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37494"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ5"
FT                   /protein_id="ABE37494.1"
FT                   /translation="MIPSWSAWKRYPQAGRGNIEAPISPGVYEIRNANDGSLVGFEAVD
FT                   NLAMALARLQVGPKRLGGWFGRRAPAAAPELEYRVCATTTRAHARAAAEHMINRRETWF
FT                   SRAA"
     atgatcccat cctggagcgc gtggaagcgc tacccccaag ccggtcgcgg caacatcgag        60
     gcgccgatca gccccggagt ctacgagatc cgcaacgcca atgacggctc gctggtcggc       120
     ttcgaggccg tcgacaatct ggcgatggcg ctggcgcggc tgcaggtcgg gccgaagcgg       180
     ctcggcggat ggttcggacg acgcgcgccg gcggcggcgc ccgagctcga gtaccgcgtc       240
     tgcgccacca ccacgcgcgc ccacgcccgc gccgcggccg agcacatgat caatcgtcgc       300
     gagacctggt tcagccgcgc cgcctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page