(data stored in ACNUC7421 zone)

EMBL: CP000283.PE263

CP000283.PE263       Location/Qualifiers
FT   CDS_pept        303023..304009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37503"
FT                   /db_xref="GOA:Q13EI6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI6"
FT                   /protein_id="ABE37503.1"
FT                   /translation="MPQLQDFRTGKPAFYPDQAIYAEYACARLGLRFSERDGGTGLLFA
FT                   VASGTKEICFGGGRCSYYPQNNATAASLATDKYLANALLERAGVATLGGRYFFLHDRHR
FT                   ALRPPGHERKDALDYLAAQGGHAFAKPLTGSRGDFARPIESAAALASYLDDVARYYDSV
FT                   LIQPYASGHEYRVFVVDGEALYTARKLPPAVIGDGVRSLRELLHEHDRALRDRGLSGAS
FT                   GDDPSLDQVPAAGERRDIAGRMNLSVGGAMVMEEAGAPAIAGARAATRALGLRLGAVDL
FT                   FVDPDARDDVRVIEVNSNPAIRFLESCGRDDLIVAIWRHSLTAAGLL"
     atgccgcaac tgcaggattt tcgaaccggg aagccggcct tctatcccga tcaggcgatc        60
     tacgccgaat atgcctgcgc gcggctcggc ctccgcttca gcgaacgcga cggcggcacc       120
     ggcctgttgt tcgccgtcgc ctcggggacg aaggaaatct gcttcggcgg cgggcgttgc       180
     tcgtattatc cgcagaacaa cgccaccgca gcatcgctcg cgaccgacaa atatctcgcc       240
     aatgcgctgc tggaacgcgc cggcgtggcg acgctcggcg gccgctattt cttcctgcac       300
     gaccgccacc gcgcgctgcg accgcccggg cacgaacgca aagatgcgct tgactatctc       360
     gcagcgcagg gcggccacgc cttcgccaag ccgctcaccg gctcgcgcgg cgactttgcg       420
     cggccgatcg agagcgccgc ggcgctggcc tcctatctcg acgatgtcgc gcgctattac       480
     gattccgtgc tgatccagcc ctatgcctca ggccacgagt atcgcgtgtt cgtggtcgac       540
     ggcgaagcgc tgtacaccgc gcgaaagctg ccgccggcgg tgatcggcga cggcgtccgc       600
     agcctgcgtg agctgctgca cgaacacgac cgcgcgttgc gcgaccgcgg attgtcgggc       660
     gcgagcggcg acgatccgtc gctcgatcag gtgcccgcgg ccggcgagcg gcgcgacatc       720
     gcgggccgga tgaatctcag cgtcggcggc gcgatggtga tggaggaggc cggcgcgccg       780
     gcgatcgcag gcgcccgagc cgcgacgcgc gcgctcggcc tgcggctcgg cgcggtcgat       840
     ctgttcgtcg atccggacgc gcgcgacgac gtgcgggtga tcgaggtgaa ttccaatccc       900
     gcgatccgct ttctcgaaag ctgcggccgc gacgatctga tcgtcgcgat ctggcgtcac       960
     agtctcaccg cagcaggatt gttgtag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page