(data stored in ACNUC7421 zone)

EMBL: CP000283.PE264

CP000283.PE264       Location/Qualifiers
FT   CDS_pept        304010..305326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0264"
FT                   /product="FolC bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37504"
FT                   /db_xref="GOA:Q13EI5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI5"
FT                   /protein_id="ABE37504.1"
FT                   /translation="MFDLPKYGEGICLARLAVLLDRLGVDRARLQRIAVAVCGSNGKGS
FT                   TAAFTAGIGRAHGLRTGLFTSPHLYRFNERFQIDGAPIPDDALRRLLERVTKAIAEVGE
FT                   ARGEQFGAFEAQFALACLYFQDNACDFAVFEAGIGGRYDPVRLLGARVSCVTSVDLEHV
FT                   ALLGHSIELIASDKSDACAAGGVIVYGENCRPLRDHLAEYNRNREVAALFIGDEIGIGS
FT                   ASIADARQRFDLRIEDHTYVALETSLLGPFQVNNAAIAASLFALWLRQSGTDHDPARLD
FT                   AAIRHGLRDARWPGRLETISTEPLTVIDVGHTPDGIRQALAGLRAAHGESGWILVLGAS
FT                   RDKNAAEIVAALAPSFDAIVCSSAHHKGAPAEVIAEAARAANPRAEIVTAATVADAVGE
FT                   ARMLAERLDARIYVAGGLFLAIEFAAVTRGGRAEDLRFF"
     atgttcgatc ttccgaaata cggcgaaggg atttgtctcg cgcggctggc cgtgctgctc        60
     gatcggctcg gcgtcgatcg cgcgcggctg cagcgcatcg ccgtcgcggt ctgcggctcc       120
     aacggcaagg gctcgaccgc ggcgttcacc gccggcatcg gtcgcgctca cggcctgcgc       180
     accgggctgt tcacctcgcc gcatttgtat cgcttcaacg aacgcttcca gatcgacggc       240
     gcgccgatcc ccgacgatgc gctgaggcgg ctgctggagc gcgtgacaaa ggccatcgcg       300
     gaggtgggag aagcccgcgg cgagcagttc ggcgcattcg aggcgcagtt cgcgctggcg       360
     tgtttgtact tccaggacaa tgcctgcgac ttcgcggtgt tcgaggccgg gatcggcggc       420
     cgctacgatc cggtgcgcct gctcggcgcg cgcgtgagct gcgtcacctc ggtcgatctc       480
     gaacacgtgg cgctgctcgg ccattcgatc gagctgatcg cctccgacaa gagcgacgcc       540
     tgcgcggccg gcggcgtcat cgtctatggc gagaattgcc ggccgttgcg cgatcatctc       600
     gccgaataca atcgcaaccg cgaggtcgcc gcgctgttca tcggcgacga gatcggcatc       660
     ggcagcgcca gcatcgcgga cgcgcggcag cgcttcgatc tgcggatcga agaccacacc       720
     tacgtggcgc tcgaaacctc gctgctcggc ccgttccagg tcaacaacgc cgcgatcgcg       780
     gcgtcgctgt tcgcgctgtg gctgcggcag agcggcaccg accacgatcc ggcgcggctc       840
     gatgctgcga tccgccacgg cctgcgcgat gcgcgatggc cgggacggct ggagacaatc       900
     agcacagagc cgctgacagt gatcgacgtc ggccacaccc ctgacggcat ccggcaggcg       960
     ctggcgggtc ttcgcgcggc gcatggcgaa agcggatgga ttctggtgct cggcgcgtcg      1020
     cgcgacaaga acgccgccga gatcgtcgcg gcgctggcgc cgtccttcga cgccatcgtc      1080
     tgtagctcgg cgcatcacaa gggcgcgccc gccgaagtca tcgcggaagc cgcgcgcgcg      1140
     gcgaatccgc gcgccgagat cgtcacggct gcgaccgtgg ccgacgccgt aggcgaggcg      1200
     cgcatgctgg ccgaacggct cgacgcccgg atctacgtcg cgggcggatt gtttctcgcg      1260
     atcgaattcg ccgccgtcac gcgaggcgga cgcgccgagg atcttcggtt cttctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page