(data stored in ACNUC7421 zone)

EMBL: CP000283.PE266

CP000283.PE266       Location/Qualifiers
FT   CDS_pept        complement(306439..306675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37506"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI3"
FT                   /protein_id="ABE37506.1"
FT                   /translation="MVSIPRGERLQIMLTEDEYHALDLWRFSRHMPSRAAAVRELLRRG
FT                   LSAEGFAVSDGTRKSSDFGLIGKSSAETDGRQP"
     atggtgtcga ttccccgtgg agagcgtctt cagatcatgc tgaccgaaga cgagtatcat        60
     gccttggacc tctggcgatt cagtcgccac atgccgagcc gcgctgccgc tgtgcgcgaa       120
     ttgctgcgtc gcggactgag cgccgaaggc ttcgccgttt cggacggcac ccggaaatcg       180
     agcgatttcg gtctcattgg aaaatcaagc gctgagaccg acggtcgcca accctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page