(data stored in ACNUC7421 zone)

EMBL: CP000283.PE27

CP000283.PE27        Location/Qualifiers
FT   CDS_pept        33552..35345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37267"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F72"
FT                   /protein_id="ABE37267.1"
FT                   /translation="MLPTSPHRNVGEGAIGFLMRLGETHGVRKFCDMLRDLGIRRFDLS
FT                   QGIGVDRVARAAMVARAALQFDSGTRTRQGVMLRGELLRPRQWSVHAGRRGCPACFAGD
FT                   RDGTVLPRQWHRAWWDIRAVTVCPLHGLLLIDACPRCGVPLDFKVNAIGQCRNGHPLWD
FT                   SSPERVTGFAGDEYIVGRLVGSDRIPNSLLDAGRLGEAIDALDLVGRCVLAGHHTGGSG
FT                   GLRRHVVLAAGFECFIDWPAAFDPLLDGLLRSSKQGVGKWGAAAAYGPLHYGLQELGCG
FT                   RIAMEMKAHLRRHAAANGVSISKPVFGTVPNVTGIYSVRHAARRFGMGFEGTRTLLARE
FT                   GVVPEETRRGTPIRISTAVVDRLATERSLTVGLGRLADHLALGRGQTRRLVGAGFLGDR
FT                   RPRPSLADADAMLAKLCIGAPANWDRSETASLPDACRSARCSIEVAVRSILAGAPDVKG
FT                   YRPGAGLRGIFVRVSDLRAVGKLSRGRLTLADAAAALRVKWETARALAADGLLVTADDG
FT                   VHPSALDNFQRDFIAAADLAKVARVRSQSLIKQLSGMGVSPAAGPPNCRQVFYRRSSLR
FT                   AVRALRRKLPGVYARALGQSR"
     atgctgccga ctagccctca ccgcaatgtc ggcgagggcg ctatcggctt cttgatgcgg        60
     ctgggcgaga cccatggcgt tcggaagttt tgcgacatgc tgcgcgacct cggcattcgt       120
     cggttcgatc tgtcacaggg cataggcgtc gaccgcgtgg cgcgggcggc gatggttgcg       180
     cgggcggcac tgcaattcga cagcggcacc aggacgagac aaggtgtaat gctgcggggc       240
     gagctgctac gcccccgcca gtggtcggtg catgccggcc gccgcggatg cccggcgtgt       300
     tttgctggcg accgtgacgg gacggtgctg ccgcgacagt ggcatcgcgc ctggtgggac       360
     atccgggctg taacggtctg tccgctgcat gggctcctgc tgatcgacgc ctgcccgcgt       420
     tgcggcgtgc cgctggattt caaggtcaac gcgatcggcc agtgccgcaa cgggcatcca       480
     ctttgggact cgtctccgga gcgggtgacc ggcttcgccg gcgacgaata catagtgggt       540
     cgactcgttg gtagcgaccg gatcccgaat tcgcttttgg acgctggtcg ccttggcgag       600
     gcgatcgacg cgttggattt ggtcggtcgc tgcgtgctgg cggggcatca caccggcggg       660
     tcgggcgggc tccgtcgtca tgtggtgctg gcggcgggat tcgagtgttt catcgactgg       720
     cctgcggcct ttgacccatt gcttgatggc ctgttgcgct catcaaaaca gggtgtggga       780
     aaatggggag ctgcggcggc ctacggcccg ctgcactatg gcctgcagga gcttggctgc       840
     ggccggatcg caatggagat gaaggcgcac ctgcgtcgtc acgcggcggc gaacggtgtt       900
     tcgatctcga agccggtttt cggcacagtg ccgaacgtga ctggtatcta ctcggttcgg       960
     cacgccgcac ggcggtttgg aatggggttt gaagggactc gcacgttgct ggcgcgcgag      1020
     ggtgtcgttc cggaggagac ccgccgcggc acgccgatta ggatctcgac ggccgtggtc      1080
     gaccggctgg cgaccgaacg cagcctgacg gtcgggctgg gacggcttgc cgaccatctg      1140
     gcacttggac gcggccagac ccggcgtctc gtcggcgctg gttttctcgg cgaccgccga      1200
     cctcggcctt cgcttgcgga tgctgacgcg atgctggcca agctttgcat cggcgcgccg      1260
     gccaattggg atcgatcgga aacggcttcg ttgccggatg cctgccgtag cgcgcggtgt      1320
     tcgattgagg tggcggtgcg atcgattctc gctggggccc cggatgtgaa ggggtatcgc      1380
     cccggcgccg ggctgagggg catcttcgtt cgggtttcgg atctgcgcgc cgtcggtaaa      1440
     ctgtcgcgcg gccggttgac gctggcggac gctgccgcag cgctaagagt gaaatgggag      1500
     actgcgcggg cgttggcggc agacggccta ttggtaacgg cggacgatgg cgtgcatccg      1560
     tcggcgctcg ataatttcca gcgcgacttc attgcggcgg ccgatctggc gaaggttgct      1620
     cgtgttcgct cgcaaagcct catcaagcag ctgtctggga tgggcgtgtc gcccgccgcc      1680
     ggaccgccga attgccgcca ggttttctat cgtcgatcaa gtttgcgggc agtgcgcgcg      1740
     ctgagacgca aacttccggg cgtttacgcc cgagctttag ggcagtcccg atga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page