(data stored in ACNUC7421 zone)

EMBL: CP000283.PE285

CP000283.PE285       Location/Qualifiers
FT   CDS_pept        complement(330097..331176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37525"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG4"
FT                   /protein_id="ABE37525.1"
FT                   /translation="MTTGDGGAAAGRLLSRRRVVALAAGLAFAAHPALAQSQAQRFDPE
FT                   EFSTPAPERIEVRARPIESFDLRDRASRRFGALQFRSGLVLTSPFRGFGGLSGLKLDPK
FT                   GERFVAINDRGAWITGRIVYSGAEMTGLADVEAAPLLGPDGQPLTRRKWYDSESLAFDG
FT                   GTAYVGFERVNQIVKFDFGRDGVRALGQPIAVPPALRKLPNNKGIESLVAVPKGQPLAG
FT                   TLIAISERGLDADRNVIGFLIGGKTPGQFAVRRTEDFDISDAMLLPSGQLLILERKFSW
FT                   IHGVHIRIRRIALSTLTPGAIVDGPALFNADLGHEIDNMEGIDAHLDASGATVLTLVSD
FT                   DNFSMLQRTLLLQFTLVED"
     gtgaccactg gcgacggcgg ggccgcagcg gggcggttgc tcagccgccg ccgcgtcgtc        60
     gcactcgccg cgggtctcgc tttcgcggcg cacccggcgc tggcgcagag ccaagcgcag       120
     cgcttcgatc cggaggaatt ctccaccccg gcccccgagc gcatcgaggt gcgggcgcgg       180
     ccgatcgagt ccttcgatct ccgcgaccgc gccagccgac ggttcggcgc gctgcagttt       240
     cgcagcggtc tggtgctgac ctcgccgttc cgcggcttcg gcggcctgtc ggggctgaag       300
     ctcgatccga aaggcgagcg cttcgtcgcg atcaatgacc gcggcgcctg gatcaccggc       360
     cgcatcgtgt acagcggcgc cgagatgacc gggctcgccg acgtcgaggc ggcgccgctg       420
     ctcggccccg atggacagcc gctgacgcgg cgcaaatggt acgatagtga atcgctcgca       480
     ttcgacggcg gcacagccta tgtcggcttc gaacgcgtca accagatcgt gaaattcgac       540
     ttcggccgcg acggcgtccg ggcgttgggg cagccgatcg cggtgccgcc ggcgctgcgc       600
     aaattgccga acaacaaggg catcgaatcg ctggtggcgg tgccgaaggg ccagccgctg       660
     gccggaacgc tgattgcgat ctccgagcgt ggtctcgacg ccgatcgcaa cgtcatcggc       720
     tttctgatcg gcggaaaaac ccctggccag ttcgcggttc gccgcaccga ggatttcgac       780
     atcagcgatg cgatgctgct accatcgggc caattgctga tcctcgagcg caagttctcc       840
     tggatccacg gcgtgcacat ccggatcagg cggatcgcgc tgtcgacgct gacgcccggc       900
     gcgatcgtcg acggccccgc gcttttcaac gccgatctag gccacgagat cgacaacatg       960
     gaaggcatcg acgcgcatct cgacgcgtcc ggcgccaccg tgctgacgct ggtctcggac      1020
     gacaattttt cgatgctgca gcggacgttg ctgttgcagt tcaccctcgt cgaggattga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page