(data stored in ACNUC7421 zone)

EMBL: CP000283.PE288

CP000283.PE288       Location/Qualifiers
FT   CDS_pept        complement(334887..335534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0290"
FT                   /product="heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37528"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG1"
FT                   /protein_id="ABE37528.1"
FT                   /translation="MAIDSSKFFDKIRVKPTKAEAAREAAREQVIMCDAPGCANRGAHR
FT                   APKGRGLEKDYWHFCLNHVREYNQGYNFFEGMNADAVARYQKDALTGHRPTWKMGQNGA
FT                   KSRTKNPEDLAGAADPFEVINEFNGRSRWRRGPDPSAEQTKSEPRKVFNAERKALQVMG
FT                   LDGDATLDIVKAKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVRA"
     atggcaatcg actcgtccaa attcttcgac aagatccgcg tcaagccgac caaggcagag        60
     gcggcgcggg aggctgcgcg cgagcaggtg atcatgtgcg acgcgccggg ctgcgccaat       120
     cgcggcgcgc atcgcgcccc gaagggccgc ggtctggaga aggattactg gcacttctgc       180
     ctgaatcacg tccgcgaata caatcagggc tacaacttct tcgaaggcat gaatgccgac       240
     gcggtggcgc gctatcagaa ggacgcgctg accgggcatc gcccgacctg gaagatgggc       300
     cagaacggcg ccaagagccg gaccaagaac cccgaggatc tcgccggcgc cgccgatccg       360
     ttcgaagtca tcaacgagtt caacggccgc agccgctggc ggcgcgggcc ggatccgtcg       420
     gccgagcaga ccaagtccga gccgcgcaag gtgttcaacg ccgagcgcaa ggcgctgcag       480
     gtgatggggc tcgacggcga cgcgacgctc gacatcgtca aggcgaagta caaggcgctg       540
     gtcaagcagc atcatcccga cgccaatggc ggcgaccgct cgaccgagga tcgcctgatc       600
     gagatcatca aggcgtataa ttacttgaag accgtggtcc gcgcctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page