(data stored in ACNUC7421 zone)

EMBL: CP000283.PE290

CP000283.PE290       Location/Qualifiers
FT   CDS_pept        complement(335951..337273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0292"
FT                   /product="protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37530"
FT                   /db_xref="GOA:Q13EF9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF9"
FT                   /protein_id="ABE37530.1"
FT                   /translation="MDWLTFGIVIACLFGSAFFSASETALTAASRANMMRLAKQGSRNA
FT                   GIVGRLLAVRERMIGALLLGNNIFNIGASALATGLFTAWFGELGVLYATAVMTVLVVIF
FT                   AEVLPKTIAINAPDRFALLVAKPMRAMVLVLGPLLTVIEALVRVLMRLMGVKVGAHQSL
FT                   LTATERLRGAVELIHHEGGVAKHDRDMFGGLLDLSELQVSDVMVHRTEMVMVNADLPPE
FT                   ELVREVLATEYTRIPLWREKPENIIGVLHAKDLLRAMRAAEGDASNIDVTKIALPPWFV
FT                   PEMRLVSEQLKAFRSRKTHFALVVDEYGEVEGMVTLEDILEEIVGDISDEHDIVVAGVR
FT                   TQPDGSVVVDGSVPIRDLNRAMDWNLPDEEATTIAGLVIHEARSIPDRGQSFTFHGFRF
FT                   RVLRRERNRITALRIVPVPRETEAEAADKKKGKIARIGPVP"
     atggactggt tgacgttcgg catcgtgatc gcgtgtctgt tcggctcggc gttcttctcc        60
     gccagcgaga ccgcgctgac cgcggcctcg cgcgccaaca tgatgcggct ggcgaagcag       120
     ggcagtcgca acgccgggat cgtcggccgg ctgctcgccg tgcgcgagcg gatgatcggc       180
     gcgctgctgc tcggcaacaa catcttcaac atcggcgcat cggcgctggc gaccggcctg       240
     ttcaccgcgt ggttcggcga gctcggcgtg ctctacgcca ctgcggtgat gaccgtgctg       300
     gtggtgatct tcgccgaggt gctgccgaag accatcgcca tcaacgcgcc ggaccgcttc       360
     gcgctgctgg tggcgaagcc gatgcgggcg atggtgctgg tgctcggtcc gctgctcacg       420
     gtgatcgagg cgcttgttcg cgtcctgatg cggctgatgg gcgtgaaggt cggcgcgcac       480
     cagtcgctgc tgacggcgac cgagcggctg cgcggcgcgg tcgaactcat tcatcacgaa       540
     ggcggcgtcg ccaagcacga ccgcgacatg ttcggcggcc tgctcgatct cagcgaattg       600
     caggtctcgg acgtgatggt ccaccgcacc gagatggtga tggtcaacgc cgatctgccg       660
     ccggaagaat tggtgcgcga ggtgctggcg accgagtaca cgcggattcc gctgtggcgc       720
     gagaagccgg agaacatcat cggcgtcctt cacgccaagg atctgctgcg cgcgatgcgc       780
     gcggccgagg gcgacgcgag caatatcgac gtcaccaaga tcgcgctgcc gccgtggttc       840
     gtgccggaga tgcgactggt gtcggagcag ctcaaggcgt tccgctcacg caagactcac       900
     ttcgcgctgg tggtcgacga atacggcgaa gtcgaaggca tggtgacgct cgaggatatc       960
     ctcgaggaga tcgtcggcga catctccgac gagcacgaca tcgtggtggc cggcgtccgc      1020
     acccagcccg acggctcggt ggtggtggac ggctcggtgc cgatccgcga tctcaaccgc      1080
     gcgatggact ggaacctgcc ggacgaggag gcgaccacga tcgccggcct ggtgatccac      1140
     gaggcgcgct cgattccgga ccgcggccag agcttcacct tccacggctt ccgcttccgc      1200
     gtgctgcgcc gcgagcgcaa tcgcatcacc gcgctgcgca tcgtgccggt tccgcgcgag      1260
     acggaagccg aggcggccga caagaagaag ggaaagatcg cgcgaatcgg tccggtgccg      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page